KpATCC43816 Protein target profile

bacterial extracellular solute-binding, 3 familyprotein

Accession: VK055_3024

Gene: AIK81609.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GLY4

Export view

Length 526

Pocket druggability (P2Rank · AlphaFold DB model) 0.683

Direct ligand evidence 0 52 total records

Functional annotation 0 EC 0 GO

Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Moderate predicted binding pocket FPocket selected-pocket score 0.66. This supports review but is not experimental validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.68. Structure available AlphaFold DB model + ColabFold model Review the complete evidence below

Risks to review

Evidence coverage

Core evidence streams are available for this target.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target: No hit
Gut microbiome similarity: 0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG): N
DEG identity (%): 0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT: 85.5 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.683

Structure A0A0H3GLY4

Pocket Pocket 1

Druggability (FPocket) 0.66

Structure A0A0H3GLY4

Pocket Pocket 4

ColabFold model

P2Rank 0.85 · Pocket 1

FPocket 0.725 · Pocket 30

Core conservation Accessory gene

Roary core

CoreCruncher accessory

Gut microbiome 17 / 4744 genomes with a hit

Prevalence 0.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MNAYSLSRLFIAWLTCLATLLFAPLLPAVEAEKAPPAAAEDNTLSIHIDDMLRPWRGDLPGMIDRRTIRVLTTYSKTFFFIDKGTQRGATHDIFIALENDLNKQLAKDKKLKQRHLKLHIVFVPVSRDNLFIALNEGKGDIAAANLTITPSREAQVDFAQPLYSNVKELLISGPASPKVDSLEQLSGQTVFVRRSSSYYDSLQALNARFAGESRPPVILEAAPEALEDEDLLEMLNAGLIPLIVVDQHKALFWKQVFPKIQVHDNVVLRDGGDIAWAVRKDSPQLLTVLNNFVKKNRQGTTLGNTLLLRYLKNAKYVKNAAASKERRKFLAMVDVFRKYGDRYDVDWLLMAAQGYQESRLNQSVRSHVGAIGVMQVMPSTGKELKVGDIKQLDPNIHAGVKYMRWMMDRYYADEPMTRLDKALFTFASYNAGPARIARLRTMTKQRGFDPNVWFGNVENMAAEKIGAETVTYVSNIYKYYIAYRLIVDDMARKQKATAVPRQEPVAQPAKPQPSVATAATAQVPVI

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

Subcellular localization

Localization: Cytoplasmic

No GO or EC annotations are currently loaded for this protein.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

23 records

Show feature table

Start	End	DB	Term	Name
11	26	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
67	302	SUPERFAMILY	SSF53850	Periplasmic binding protein-like II
1	10	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
166	270	Gene3D	G3DSA:3.40.190.10	-
67	314	SMART	SM00062	AABind_6
67	314	InterPro	IPR001638	Solute-binding protein family 3/N-terminal domain of MltF
66	312	CDD	cd01009	PBP2_YfhD_N
336	484	CDD	cd13403	MLTF-like
32	526	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
114	302	Pfam	PF00497	Bacterial extracellular solute-binding proteins, family 3
114	302	InterPro	IPR001638	Solute-binding protein family 3/N-terminal domain of MltF
27	31	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
8	302	PANTHER	PTHR35936	MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
64	303	Gene3D	G3DSA:3.40.190.10	-
332	486	SUPERFAMILY	SSF53955	Lysozyme-like
332	486	InterPro	IPR023346	Lysozyme-like domain superfamily
335	445	Pfam	PF01464	Transglycosylase SLT domain
335	445	InterPro	IPR008258	Transglycosylase SLT domain 1
7	29	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	31	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
1	31	Phobius	SIGNAL_PEPTIDE	Signal peptide region
1	31	SignalP_EUK	SignalP-noTM	SignalP-noTM
330	501	Gene3D	G3DSA:1.10.530.10	-

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low

How colors and pocket overlays are used

Uniform protein color marks the displayed model as a single molecular object.

Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.

Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.

'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.

'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.

'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.

Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1

0.683

Likely same site as FPocket 35 1.1 Å 18 shared residues 90% of smaller site

Show in viewer

Surrounding area

Pocket 2 P2Rank #2

0.531

Likely same site as FPocket 4 1.3 Å 12 shared residues 86% of smaller site

Show in viewer

Surrounding area

Pocket 3 P2Rank #3

0.201

Show in viewer

Surrounding area

Pocket 4 P2Rank #4

0.162

Show in viewer

Surrounding area

Pocket 5 P2Rank #5

0.065

Show in viewer

Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #4

0.66

Likely same site as P2Rank 2 1.3 Å 12 shared residues 86% of smaller site

Show in viewer

Surrounding area

Pocket 2 FPocket #35

0.3 Unusual size

Likely same site as P2Rank 1 1.1 Å 18 shared residues 90% of smaller site

Show in viewer

Surrounding area

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1

0.85

Likely same site as FPocket 30 1.6 Å 25 shared residues 100% of smaller site

Show in viewer

Surrounding area

Pocket 2 P2Rank #2

0.509

Show in viewer

Surrounding area

Pocket 3 P2Rank #3

0.486

Show in viewer

Surrounding area

Pocket 4 P2Rank #4

0.435

Show in viewer

Surrounding area

Pocket 5 P2Rank #5

0.094

Show in viewer

Surrounding area

All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold DB AF_A0A0H3GLY4	AlphaFold DB	—	—	full sequence	—	Viewing
ColabFold VK055_3024	ColabFold	—	—	full sequence	—	Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records

Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records

Transferred evidence 3 records from similar proteins

Structural ligands 3 0 loaded crystals

Measured bioactivity 0 direct and transferred ChEMBL records

Proposed compounds 49 similarity-based ZINC candidates

Best available ligand signal

6X4 PDB via homolog 489.6 Da · LogP -3.89 · TPSA 244.7 Open detail RCSB PDB

BLG PDB via homolog Detail RCSB PDB

BUL PDB via homolog Detail RCSB PDB

ZINC34074657 ZINC proposed compound · Tanimoto 0.769 Detail ZINC

ZINC15722130 ZINC proposed compound · Tanimoto 0.582 Detail ZINC

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
6X4 RCSB PDB	5AA4	A0A1I9GEN8	489.6 Da LogP -3.89 TPSA 244.7	1 viol.	✓ Clean	`C[C@H](C(=O)N)NC(=O)C(CCCC[NH3+])NC(=O)CC[C@H](…`
BLG RCSB PDB	1SLY	P0AGC3	552.6 Da LogP -6.16 TPSA 271.9	3 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@H]1O[C@H]2…`
BUL RCSB PDB	6FCQ	Q9HZI6	551.5 Da LogP -5.13 TPSA 267.3	3 viol.	✓ Clean	`CC(=O)N[C@@H]1[C@H]([C@@H]([C@H](O[C@H]1O[C@H]2…`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC34074657 ZINC	0.769	444.4 Da LogP -4.05 TPSA 221.2	2 viol.	✓ Clean	`CC(=O)N[C@H]1[C@H](O[C@H]2C[C@@H](C(=O)O)N[C@@H…`
ZINC15722130 ZINC	0.582	488.5 Da LogP -2.61 TPSA 243.0	1 viol.	✓ Clean	`C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@@H](CCCCN)C(=O)…`
ZINC255987061 ZINC	0.582	488.5 Da LogP -2.61 TPSA 243.0	1 viol.	✓ Clean	`C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…`
ZINC255987062 ZINC	0.582	488.5 Da LogP -2.61 TPSA 243.0	1 viol.	✓ Clean	`C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…`
ZINC255987063 ZINC	0.582	488.5 Da LogP -2.61 TPSA 243.0	1 viol.	✓ Clean	`C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…`
ZINC255987064 ZINC	0.582	488.5 Da LogP -2.61 TPSA 243.0	1 viol.	✓ Clean	`C[C@H](N)C(=O)N[C@H](CCC(=O)N[C@H](CCCCN)C(=O)N…`
ZINC64219359 ZINC	0.565	202.3 Da LogP -0.41 TPSA 106.4	✓ Ro5	✓ Clean	`CC(C)[C@H](C(=O)[C@@H](C)N)[C@H](N)C(=O)O`
ZINC64219360 ZINC	0.565	202.3 Da LogP -0.41 TPSA 106.4	✓ Ro5	✓ Clean	`CC(C)[C@@H](C(=O)[C@@H](C)N)[C@H](N)C(=O)O`
ZINC79670384 ZINC	0.565	202.3 Da LogP -0.41 TPSA 106.4	✓ Ro5	✓ Clean	`CC(C)[C@@H](C(=O)[C@H](C)N)[C@H](N)C(=O)O`
ZINC79670387 ZINC	0.565	202.3 Da LogP -0.41 TPSA 106.4	✓ Ro5	✓ Clean	`CC(C)[C@H](C(=O)[C@H](C)N)[C@H](N)C(=O)O`
ZINC5131766 ZINC	0.538	224.3 Da LogP -1.26 TPSA 92.4	✓ Ro5	✓ Clean	`N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)O`
ZINC13529436 ZINC	0.533	212.3 Da LogP 1.76 TPSA 46.3	✓ Ro5	✓ Clean	`CC[C@H](C)[C@H](N)C(=O)N1CCCCCC1`
ZINC19502834 ZINC	0.533	212.3 Da LogP 1.76 TPSA 46.3	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@@H](N)C(=O)N1CCCCCC1`
ZINC19502836 ZINC	0.533	212.3 Da LogP 1.76 TPSA 46.3	✓ Ro5	✓ Clean	`CC[C@H](C)[C@@H](N)C(=O)N1CCCCCC1`
ZINC19502838 ZINC	0.533	212.3 Da LogP 1.76 TPSA 46.3	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@H](N)C(=O)N1CCCCCC1`
ZINC2560328 ZINC	0.520	239.1 Da LogP 1.53 TPSA 63.3	✓ Ro5	✓ Clean	`N[C@@H](CC(C(F)(F)F)C(F)(F)F)C(=O)O`
ZINC4348166 ZINC	0.520	239.1 Da LogP 1.53 TPSA 63.3	✓ Ro5	✓ Clean	`N[C@H](CC(C(F)(F)F)C(F)(F)F)C(=O)O`
ZINC1579628 ZINC	0.517	202.3 Da LogP -0.05 TPSA 92.4	✓ Ro5	✓ Clean	`CC(C)C[C@@H](N)C(=O)NCCC(=O)O`
ZINC2390984 ZINC	0.517	202.3 Da LogP -0.05 TPSA 92.4	✓ Ro5	✓ Clean	`CC(C)C[C@H](N)C(=O)NCCC(=O)O`
ZINC11959312 ZINC	0.516	213.3 Da LogP 0.13 TPSA 49.6	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@H](N)C(=O)N1CCN(C)CC1`
ZINC11959315 ZINC	0.516	213.3 Da LogP 0.13 TPSA 49.6	✓ Ro5	✓ Clean	`CC[C@H](C)[C@H](N)C(=O)N1CCN(C)CC1`
ZINC19504598 ZINC	0.516	213.3 Da LogP 0.13 TPSA 49.6	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@@H](N)C(=O)N1CCN(C)CC1`
ZINC19504599 ZINC	0.516	213.3 Da LogP 0.13 TPSA 49.6	✓ Ro5	✓ Clean	`CC[C@H](C)[C@@H](N)C(=O)N1CCN(C)CC1`
ZINC247966296 ZINC	0.510	290.3 Da LogP -1.40 TPSA 136.0	✓ Ro5	✓ Clean	`C[C@H](O)C(=O)NCCCC[C@H](NC(=O)[C@H](C)O)C(=O)O`
ZINC247966298 ZINC	0.510	290.3 Da LogP -1.40 TPSA 136.0	✓ Ro5	✓ Clean	`C[C@H](O)C(=O)NCCCC[C@@H](NC(=O)[C@@H](C)O)C(=O…`
ZINC247966301 ZINC	0.510	290.3 Da LogP -1.40 TPSA 136.0	✓ Ro5	✓ Clean	`C[C@H](O)C(=O)NCCCC[C@@H](NC(=O)[C@H](C)O)C(=O)O`
ZINC247966305 ZINC	0.510	290.3 Da LogP -1.40 TPSA 136.0	✓ Ro5	✓ Clean	`C[C@H](O)C(=O)NCCCC[C@H](NC(=O)[C@@H](C)O)C(=O)O`
ZINC11959285 ZINC	0.500	200.3 Da LogP 0.22 TPSA 55.6	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@H](N)C(=O)N1CCOCC1`
ZINC11959288 ZINC	0.500	200.3 Da LogP 0.22 TPSA 55.6	✓ Ro5	✓ Clean	`CC[C@H](C)[C@H](N)C(=O)N1CCOCC1`
ZINC11961470 ZINC	0.500	200.3 Da LogP 1.52 TPSA 55.1	✓ Ro5	✓ Clean	`CC(C)CCNC(=O)[C@@H](N)CC(C)C`
ZINC1589383 ZINC	0.500	244.3 Da LogP 0.98 TPSA 92.4	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@H](NC(=O)[C@@H](N)CC(C)C)C(=O)O`
ZINC17142439 ZINC	0.500	244.3 Da LogP 0.98 TPSA 92.4	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@@H](NC(=O)[C@@H](N)CC(C)C)C(=O)O`
ZINC17142440 ZINC	0.500	244.3 Da LogP 0.98 TPSA 92.4	✓ Ro5	✓ Clean	`CC[C@H](C)[C@@H](NC(=O)[C@@H](N)CC(C)C)C(=O)O`
ZINC19506206 ZINC	0.500	200.3 Da LogP 0.22 TPSA 55.6	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@@H](N)C(=O)N1CCOCC1`
ZINC19506207 ZINC	0.500	200.3 Da LogP 0.22 TPSA 55.6	✓ Ro5	✓ Clean	`CC[C@H](C)[C@@H](N)C(=O)N1CCOCC1`
ZINC2390960 ZINC	0.500	244.3 Da LogP 0.98 TPSA 92.4	✓ Ro5	✓ Clean	`CC[C@H](C)[C@H](NC(=O)[C@@H](N)CC(C)C)C(=O)O`
ZINC2522617 ZINC	0.500	245.3 Da LogP -1.20 TPSA 135.5	✓ Ro5	✓ Clean	`CC(C)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)O`
ZINC2562301 ZINC	0.500	244.3 Da LogP 0.98 TPSA 92.4	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@H](NC(=O)[C@H](N)CC(C)C)C(=O)O`
ZINC36158109 ZINC	0.500	221.3 Da LogP 2.10 TPSA 52.3	✓ Ro5	✓ Clean	`CC[C@H](C)[C@H](N)C(=O)OCc1ccccc1`
ZINC36158113 ZINC	0.500	221.3 Da LogP 2.10 TPSA 52.3	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@@H](N)C(=O)OCc1ccccc1`
ZINC37246007 ZINC	0.500	221.3 Da LogP 2.10 TPSA 52.3	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@H](N)C(=O)OCc1ccccc1`
ZINC37246008 ZINC	0.500	221.3 Da LogP 2.10 TPSA 52.3	✓ Ro5	✓ Clean	`CC[C@H](C)[C@@H](N)C(=O)OCc1ccccc1`
ZINC40439568 ZINC	0.500	208.2 Da LogP -2.19 TPSA 112.7	✓ Ro5	✓ Clean	`N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)O`
ZINC4556661 ZINC	0.500	245.3 Da LogP -1.20 TPSA 135.5	✓ Ro5	✓ Clean	`CC(C)C[C@@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)O`
ZINC4556662 ZINC	0.500	245.3 Da LogP -1.20 TPSA 135.5	✓ Ro5	✓ Clean	`CC(C)C[C@H](N)C(=O)N[C@H](CC(N)=O)C(=O)O`
ZINC4556663 ZINC	0.500	245.3 Da LogP -1.20 TPSA 135.5	✓ Ro5	✓ Clean	`CC(C)C[C@@H](N)C(=O)N[C@H](CC(N)=O)C(=O)O`
ZINC5618626 ZINC	0.500	244.3 Da LogP 0.98 TPSA 92.4	✓ Ro5	✓ Clean	`CC[C@H](C)[C@H](NC(=O)[C@H](N)CC(C)C)C(=O)O`
ZINC5618627 ZINC	0.500	244.3 Da LogP 0.98 TPSA 92.4	✓ Ro5	✓ Clean	`CC[C@@H](C)[C@@H](NC(=O)[C@H](N)CC(C)C)C(=O)O`
ZINC5618628 ZINC	0.500	244.3 Da LogP 0.98 TPSA 92.4	✓ Ro5	✓ Clean	`CC[C@H](C)[C@@H](NC(=O)[C@H](N)CC(C)C)C(=O)O`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GLY4