KpATCC43816 Protein target profile

short chain dehydrogenase family protein

Accession: VK055_3067

Gene: AIK81652.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GQ37
Length 267
Pocket druggability (P2Rank · AlphaFold DB model) 0.923
Direct ligand evidence 0 73 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
34.579 Lower values reduce human off-target concern.
Human E-value
3.12e-10
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
36.364 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
95.09 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.923
Structure A0A0H3GQ37
Pocket Pocket 1
Druggability (FPocket) 0.738
Structure A0A0H3GQ37
Pocket Pocket 12
ColabFold model
P2Rank 0.874 · Pocket 1
FPocket 0.365 · Pocket 9
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 114 / 4744 genomes with a hit
Prevalence 2.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MNTWLNLKDNVIIVTGGASGIGLAIVDELLSQGAHVQMIDIHGGDRHHNGDNYHFWPTDISSATEVQQTIDAIIQRWSRIDGLVNNAGVNFPRLLVDEKAPAGRYELNEAAFEKMVNINQKGVFFMSQAVARQMVKQRAGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKYGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYTKNAIPIGRAGKLSEVADFVCYLLSARASYITGVTTNIAGGKTRG

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

4
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0016616 Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
  • GO:0048038 Binding to a quinone, any member of a class of diketones derivable from aromatic compounds by conversion of two CH groups into CO groups with any necessary rearrangement of double bonds.
  • GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

26 records
Show feature table
Start End DB Term Name
8 265 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
8 265 InterPro IPR036291 NAD(P)-binding domain superfamily
1 266 Gene3D G3DSA:3.40.50.720 -
1 266 FunFam G3DSA:3.40.50.720:FF:000084 Short-chain dehydrogenase reductase
140 148 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
140 148 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
160 179 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
160 179 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
78 89 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
78 89 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
10 204 Pfam PF00106 short chain dehydrogenase
10 204 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
147 175 ProSitePatterns PS00061 Short-chain dehydrogenases/reductases family signature.
147 175 InterPro IPR020904 Short-chain dehydrogenase/reductase, conserved site
12 257 CDD cd05233 SDR_c
134 150 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
134 150 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
11 28 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
11 28 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
228 248 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
228 248 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
78 89 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
181 198 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
181 198 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
160 179 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
5 263 PANTHER PTHR42760 SHORT-CHAIN DEHYDROGENASES/REDUCTASES FAMILY MEMBER

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.923
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.061
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.038
Likely same site as FPocket 12 2.5 Å 7 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.011
Likely same site as FPocket 12 7.2 Å 3 shared residues 75% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #12
0.738
Likely same site as P2Rank 3 2.5 Å 7 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQ37
AlphaFold DB full sequence Viewing
ColabFold VK055_3067
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

73 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 23 records from similar proteins
Structural ligands 18 0 loaded crystals
Measured bioactivity 5 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
34X PDB via homolog 311.3 Da · LogP 3.05 · TPSA 85.0 Open detail RCSB PDB
36E PDB via homolog Detail RCSB PDB
36G PDB via homolog Detail RCSB PDB
36I PDB via homolog Detail RCSB PDB
36K PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
34X RCSB PDB O54438 311.3 Da LogP 3.05 TPSA 85.0 ✓ Ro5 ✓ Clean c1ccc(cc1)c2cn(c(n2)N)NC(=O)Nc3ccccc3F
36E RCSB PDB O54438 186.1 Da LogP 2.58 TPSA 28.7 ✓ Ro5 ✓ Clean c1ccc2c(c1)[nH]c(n2)C(F)(F)F
36G RCSB PDB O54438 282.3 Da LogP 3.68 TPSA 41.6 ✓ Ro5 ✓ Clean COc1ccccc1NC(=O)N2CCCc3c2cccc3
36I RCSB PDB O54438 297.4 Da LogP 3.19 TPSA 38.2 ✓ Ro5 ✓ Clean c1ccc(cc1)c2nc3ccsc3c(n2)N4CCOCC4
36K RCSB PDB O54438 310.4 Da LogP 3.71 TPSA 68.2 ✓ Ro5 ✓ Clean CCn1c2ccccc2nc1NC(=O)Nc3ccccc3OC
36P RCSB PDB O54438 312.4 Da LogP 4.07 TPSA 33.2 ✓ Ro5 ✓ Clean c1ccc2c(c1)CCN2C(=O)c3csc(n3)c4ccsc4
3X3 RCSB PDB O54438 318.3 Da LogP 3.50 TPSA 66.0 ✓ Ro5 ✓ Clean c1ccc(cc1)n2nc(nn2)c3ccccc3OCc4ccco4
8M5 RCSB PDB O54438 250.3 Da LogP 3.43 TPSA 34.0 ✓ Ro5 ✓ Clean Cn1cc(c2c1cccc2)C(=O)Nc3ccccc3
9KQ RCSB PDB O54438 273.3 Da LogP 2.88 TPSA 56.5 ✓ Ro5 ✓ Clean c1ccc(cc1)c2nc3ccccc3c(n2)n4cnnc4
B3P RCSB PDB B3R6T4 282.3 Da LogP -4.01 TPSA 145.4 1 viol. ✓ Clean C(CNC(CO)(CO)CO)CNC(CO)(CO)CO
FXE RCSB PDB O54438 326.4 Da LogP 3.23 TPSA 77.4 ✓ Ro5 ✓ Clean Cn1c2cccc(c2c(n1)NC(=O)Nc3ccccc3OC)OC
J2T RCSB PDB O54438 252.3 Da LogP 1.75 TPSA 68.0 ✓ Ro5 ✓ Clean c1cc2c(cc1Nc3ccc4nnnn4n3)CCC2
MLH RCSB PDB V5VHN7 417.3 Da LogP 4.34 TPSA 54.7 ✓ Ro5 ✓ Clean CCOC(=O)c1c2cc(c(cc2n(c1CN(C)C)c3ccccc3)Br)O
NKH RCSB PDB O54438 342.8 Da LogP 4.16 TPSA 60.5 ✓ Ro5 ✓ Clean COc1cc(c(cc1Cl)OC)NC(=O)c2cccc3c2nccc3
O74 RCSB PDB O54438 347.8 Da LogP 4.53 TPSA 53.5 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(=N/C(=C/3\C=CC=CC3=O)/N2)Nc4ccccc4…
Q7U RCSB PDB O54438 300.7 Da LogP 3.87 TPSA 59.0 ✓ Ro5 ✓ Clean Cn1c2ccccc2nc1NC(=O)Nc3ccccc3Cl
U98 RCSB PDB O54438 317.3 Da LogP 2.49 TPSA 85.1 ✓ Ro5 ✓ Clean c1cc(cc(c1)Nc2c(cccn2)S(=O)(=O)N)C(F)(F)F
WI4 RCSB PDB O54438 271.7 Da LogP 3.06 TPSA 55.6 ✓ Ro5 ✓ Clean c1ccc(c(c1)Nc2ncnc(n2)n3cccc3)Cl

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.