KpATCC43816 Protein target profile

NUDIX domain protein

Accession: VK055_3096

Gene: AIK81677.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GHB2
Length 257
Pocket druggability (P2Rank · AlphaFold DB model) 0.872
Direct ligand evidence 0 57 total records
Functional annotation 2 EC 11 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
40.741 Lower values reduce human off-target concern.
Human E-value
1.43e-19
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
28.125 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.6 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.872
Structure A0A0H3GHB2
Pocket Pocket 1
Druggability (FPocket) 0.07
Structure A0A0H3GHB2
Pocket Pocket 9
ColabFold model
P2Rank 0.823 · Pocket 1
FPocket 0.056 · Pocket 13
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 116 / 4744 genomes with a hit
Prevalence 2.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MDRIIEKLDRGWWVVSHEQKLWLPGGELPHGEAVNFDLVGQHALHIGEWQGESVWMVRQDRRHDMGSLRQVLDQDPGLFQLAGRGIQLAEFYRSHKFCGYCGHPMHASKSEWAMLCSHCRERYYPQIAPCIIVAIRRDDAILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIRVKNLRYVTSQPWPFPQSLMTAFMADYADGEIVVDKKELLTADWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEFE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 EC 11 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

2

Gene Ontology (GO)

11
  • GO:0016787 Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc.
  • GO:0000210 Catalysis of the reaction: NAD+ + H2O = AMP + NMN.
  • GO:0046872 Binding to a metal ion.
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0030145 Binding to a manganese ion (Mn).
  • GO:0035529 Catalysis of the reaction: NADH + H2O = AMP + NMNH + 2 H+.
  • GO:0110153 Catalysis of the reaction: a 5'-end NAD+-phospho-ribonucleoside in mRNA + H2O = a 5'-end phospho-adenosine-phospho-ribonucleoside in mRNA + beta-nicotinamide D-ribonucleotide + 2 H+.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0019677 The chemical reactions and pathways resulting in the breakdown of nicotinamide adenine dinucleotide (NAD+), a coenzyme that interconverts with its reduced form, NADH, in many redox and catabolic reactions.
  • GO:0006742 The chemical reactions and pathways resulting in the breakdown of nicotinamide adenine dinucleotide phosphate (NADP+), a coenzyme that interconverts with its reduced form, NADPH, in many redox and biosynthetic reactions.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
3 96 SUPERFAMILY SSF55811 Nudix
3 96 InterPro IPR015797 NUDIX hydrolase-like domain superfamily
129 250 CDD cd03429 NADH_pyrophosphatase
126 257 FunFam G3DSA:3.90.79.10:FF:000004 NADH pyrophosphatase
125 248 ProSiteProfiles PS51462 Nudix hydrolase domain profile.
125 248 InterPro IPR000086 NUDIX hydrolase domain
126 257 Gene3D G3DSA:3.90.79.10 Nucleoside Triphosphate Pyrophosphohydrolase
1 125 FunFam G3DSA:3.90.79.20:FF:000001 NADH pyrophosphatase
132 234 Pfam PF00293 NUDIX domain
132 234 InterPro IPR000086 NUDIX hydrolase domain
159 180 ProSitePatterns PS00893 Nudix box signature.
159 180 InterPro IPR020084 NUDIX hydrolase, conserved site
1 125 Gene3D G3DSA:3.90.79.20 -
1 257 Hamap MF_00297 NAD-capped RNA hydrolase NudC [nudC].
1 257 InterPro IPR022925 NAD-capped RNA hydrolase NudC
62 252 PANTHER PTHR42904 NUDIX HYDROLASE, NUDC SUBFAMILY
79 241 SUPERFAMILY SSF55811 Nudix
79 241 InterPro IPR015797 NUDIX hydrolase-like domain superfamily
93 124 Pfam PF09297 NADH pyrophosphatase zinc ribbon domain
93 124 InterPro IPR015376 Zinc ribbon, NADH pyrophosphatase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.872
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.016
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.002
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:101-101
UniProt: Binding site:111-111
UniProt: Binding site:116-116
UniProt: Binding site:119-119
UniProt: Binding site:124-124
UniProt: Binding site:158-158
UniProt: Binding site:174-174
UniProt: Binding site:178-178
UniProt: Binding site:192-199
UniProt: Binding site:219-219
UniProt: Binding site:241-241
UniProt: Binding site:69-69
UniProt: Binding site:98-98
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GHB2
AlphaFold DB full sequence Viewing
ColabFold VK055_3096
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

57 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 7 records from similar proteins
Structural ligands 7 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
2ME PDB via homolog 60.1 Da · LogP 0.65 · TPSA 9.2 Open detail RCSB PDB
8DG PDB via homolog Detail RCSB PDB
GPP PDB via homolog Detail RCSB PDB
IPR PDB via homolog Detail RCSB PDB
MGP PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2ME RCSB PDB Q9CA40 60.1 Da LogP 0.65 TPSA 9.2 ✓ Ro5 ✓ Clean CCOC
8DG RCSB PDB Q9CA40 523.2 Da LogP -2.01 TPSA 298.8 3 viol. ✓ Clean C1[C@@H]([C@H](O[C@H]1N2C3=C(C(=O)NC(=N3)N)NC2=…
GPP RCSB PDB Q9CA40 314.2 Da LogP 2.91 TPSA 113.3 ✓ Ro5 ✓ Clean CC(=CCC/C(=C/CO[P@@](=O)(O)OP(=O)(O)O)/C)C
IPR RCSB PDB Q9CA40 248.1 Da LogP 1.26 TPSA 113.3 ✓ Ro5 ✓ Clean CC(C)CCO[P@@](=O)(O)OP(=O)(O)O
MGP RCSB PDB Q9BQG2 538.2 Da LogP -2.91 TPSA 290.1 3 viol. ✓ Clean C[n+]1cn(c2c1C(=O)NC(=N2)N)[C@H]3[C@@H]([C@@H](…
NH4 RCSB PDB Q9CA40 18.0 Da LogP 0.38 TPSA 36.5 ✓ Ro5 ✓ Clean [NH4+]
NMN RCSB PDB P32664 335.2 Da LogP -2.20 TPSA 163.4 ✓ Ro5 ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.