Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 38.667 Lower values reduce human off-target concern.
- Human E-value
- 7.16e-06
- Gut microbiome similarity
- 60.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 98.347 Higher values support similarity to known essential genes.
- DEG E-value
- 1.83e-75 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 75.91 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSITKDQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDAEALKKSLEEAGAEVEVK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Gene Ontology (GO)
5- GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome.
- GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
- GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
- GO:0022625 The large subunit of a ribosome located in the cytosol.
- GO:0003729 Binding to messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 51 | 121 | Gene3D | G3DSA:3.30.1390.10 | - |
| 51 | 121 | InterPro | IPR014719 | Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like |
| 3 | 120 | CDD | cd00387 | Ribosomal_L7_L12 |
| 3 | 120 | InterPro | IPR000206 | Ribosomal protein L7/L12 |
| 2 | 50 | FunFam | G3DSA:1.20.5.710:FF:000001 | 50S ribosomal protein L7/L12 |
| 55 | 121 | Pfam | PF00542 | Ribosomal protein L7/L12 C-terminal domain |
| 55 | 121 | InterPro | IPR013823 | Ribosomal protein L7/L12, C-terminal |
| 101 | 121 | Coils | Coil | Coil |
| 3 | 57 | SUPERFAMILY | SSF48300 | Ribosomal protein L7/12, oligomerisation (N-terminal) domain |
| 3 | 57 | InterPro | IPR036235 | Ribosomal protein L7/L12, oligomerisation domain superfamily |
| 6 | 120 | PANTHER | PTHR45987 | 39S RIBOSOMAL PROTEIN L12 |
| 6 | 120 | InterPro | IPR000206 | Ribosomal protein L7/L12 |
| 50 | 121 | SUPERFAMILY | SSF54736 | ClpS-like |
| 50 | 121 | InterPro | IPR014719 | Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like |
| 1 | 121 | NCBIfam | TIGR00855 | 50S ribosomal protein L7/L12 |
| 1 | 121 | InterPro | IPR000206 | Ribosomal protein L7/L12 |
| 2 | 50 | Gene3D | G3DSA:1.20.5.710 | Single helix bin |
| 2 | 50 | InterPro | IPR036235 | Ribosomal protein L7/L12, oligomerisation domain superfamily |
| 4 | 49 | Pfam | PF16320 | Ribosomal protein L7/L12 dimerisation domain |
| 4 | 49 | InterPro | IPR008932 | Ribosomal protein L7/L12, oligomerisation |
| 2 | 121 | Hamap | MF_00368 | 50S ribosomal protein L7/L12 [rplL]. |
| 2 | 121 | InterPro | IPR000206 | Ribosomal protein L7/L12 |
| 51 | 121 | FunFam | G3DSA:3.30.1390.10:FF:000001 | 50S ribosomal protein L7/L12 |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GH99
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_3111
|
ColabFold | — | — | full sequence | — | Loaded |
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.