Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 75.706 Higher values support similarity to known essential genes.
- DEG E-value
- 8.23e-102 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 95.74 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKTLILFSTRDGQTREIASFLASELKELGIDADTLNLNRTDVVEWHHYDRVVIGASIRYGHFHPAVDRFVKKHLAALQALPGAFFSVNLVARKPEKRTPQTNSYTRKFLLNSPWQPQSCAVFAGALRYPRYSWYDRFMIRLIMKMTGGETDTRKEVVYTDWQQVSRFAREIAQMARK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Unknown
Enzyme Commission (EC)
1Gene Ontology (GO)
7- GO:0006782 The chemical reactions and pathways resulting in the formation of protoporphyrinogen IX.
- GO:0010181 Binding to flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
- GO:0006783 The chemical reactions and pathways resulting in the formation of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring, from less complex precursors.
- GO:0004729 Catalysis of the reaction: 3 O2 + protoporphyrinogen IX = 3 H2O2 + protoporphyrin IX.
- GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
- GO:0070819 Catalysis of the reaction: protoporphyrinogen IX + menaquinone = protoporphyrin IX + reduced menaquinone.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 173 | Hamap | MF_00853 | Protoporphyrinogen IX dehydrogenase [quinone] [hemG]. |
| 4 | 173 | InterPro | IPR044264 | Protoporphyrinogen IX dehydrogenase [quinone] HemG |
| 3 | 177 | ProSiteProfiles | PS50902 | Flavodoxin-like domain profile. |
| 3 | 177 | InterPro | IPR008254 | Flavodoxin/nitric oxide synthase |
| 1 | 173 | PANTHER | PTHR38030 | PROTOPORPHYRINOGEN IX DEHYDROGENASE [MENAQUINONE] |
| 1 | 173 | SUPERFAMILY | SSF52218 | Flavoproteins |
| 1 | 173 | InterPro | IPR029039 | Flavoprotein-like superfamily |
| 2 | 174 | FunFam | G3DSA:3.40.50.360:FF:000017 | Protoporphyrinogen oxidase (PPO) |
| 1 | 177 | Gene3D | G3DSA:3.40.50.360 | - |
| 1 | 177 | InterPro | IPR029039 | Flavoprotein-like superfamily |
| 4 | 152 | Pfam | PF12724 | Flavodoxin domain |
| 4 | 152 | InterPro | IPR026816 | Flavodoxin domain |
| 5 | 21 | ProSitePatterns | PS00201 | Flavodoxin signature. |
| 5 | 21 | InterPro | IPR001226 | Flavodoxin, conserved site |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GH88
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_3131
|
ColabFold | — | — | full sequence | — | Loaded |
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.