Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 26.855 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 95.76 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
PDB experimental structureP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MYQVVASDLDGTLLAPDHFLTPYAKETLKLLTARGINFVFATGRHYIDVGQIRDNLGIRSYMITSNGARVHDSDGQQIFAHNLDRDIAADLFEIVRNDPKIVTNVYREDEWYMNRHRPEEMRFFKEAVFNYKLYEPGELDPQGISKVFFTCEDHEHLLPLEQAMNARWGDRVNVSFSTLTCLEVMAGGVSKGHALEAVAKMLGYTLSDCIAFGDGMNDAEMLSMAGKGCIMANAHQRLKDLHPELEVIGSNADDAVPHYLRKLYLD
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
1- GO:0016787 Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 4 | 262 | CDD | cd07516 | HAD_Pase |
| 2 | 264 | PANTHER | PTHR47267 | - |
| 84 | 187 | Gene3D | G3DSA:3.30.1240.10 | - |
| 4 | 260 | NCBIfam | TIGR00099 | Cof-type HAD-IIB family hydrolase |
| 4 | 260 | InterPro | IPR000150 | Cof family |
| 4 | 15 | ProSitePatterns | PS01228 | Hypothetical cof family signature 1. |
| 1 | 264 | SFLD | SFLDG01144 | C2.B.4: PGP Like |
| 3 | 263 | Gene3D | G3DSA:3.40.50.1000 | - |
| 3 | 263 | InterPro | IPR023214 | HAD superfamily |
| 1 | 264 | SUPERFAMILY | SSF56784 | HAD-like |
| 1 | 264 | InterPro | IPR036412 | HAD-like superfamily |
| 5 | 260 | Pfam | PF08282 | haloacid dehalogenase-like hydrolase |
| 1 | 264 | SFLD | SFLDG01140 | C2.B: Phosphomannomutase and Phosphatase Like |
| 5 | 231 | NCBIfam | TIGR01484 | HAD-IIB family hydrolase |
| 5 | 231 | InterPro | IPR006379 | HAD-superfamily hydrolase, subfamily IIB |
| 212 | 234 | ProSitePatterns | PS01229 | Hypothetical cof family signature 2. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AF3 RCSB PDB | P75792 | 84.0 Da LogP 0.88 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
F[Al](F)F
|
|
| G3H RCSB PDB | Q8IJ74 | 170.1 Da LogP -1.34 TPSA 104.1 | ✓ Ro5 | ✓ Clean |
C([C@H](C=O)O)OP(=O)(O)O
|
|
| G6P RCSB PDB | Q8IJ74 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
C([C@@H]1[C@H]([C@@H]([C@H]([C@H](O1)O)O)O)O)OP…
|
|
| M6P RCSB PDB | Q8IJ74 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
C([C@@H]1[C@H]([C@@H]([C@@H]([C@H](O1)O)O)O)O)O…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100351935 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O)[C@H](O)[C@H](O)[C@@…
|
| ZINC1529564 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@@H](O)[C@H](O)[C@H](O)[C@…
|
| ZINC1532533 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O)[C@@H](O)[C@H](O)[C@…
|
| ZINC1532857 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@@H](O)[C@@H](O)[C@H](O)[C…
|
| ZINC3581460 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@@H](O)[C@@H](O)[C@H](O)[C…
|
| ZINC38276879 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](O)[C@@H](O)[C@H](O)[C@…
|
| ZINC38276880 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O)[C@@H](O)[C@H](O)[C@H…
|
| ZINC3869397 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](O)[C@@H](O)[C@@H](O)[C…
|
| ZINC3875374 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@…
|
| ZINC3875375 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@@…
|
| ZINC4095545 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@…
|
| ZINC4095546 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H…
|
| ZINC4096188 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O)[C@@H](O)[C@@H](O)[C@…
|
| ZINC8551507 ZINC | 1.000 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O)[C@@H](O)[C@H](O)[C@…
|
| ZINC12504154 ZINC | 0.962 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O)[C@@H](O)[C@@H]1O
|
| ZINC1532546 ZINC | 0.962 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O)[C@@H](O)[C@H]1O
|
| ZINC4096190 ZINC | 0.962 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O)[C@H](O)[C@@H]1O
|
| ZINC4228241 ZINC | 0.962 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](O)[C@H](O)[C@@H]1O
|
| ZINC4521831 ZINC | 0.962 | 230.1 Da LogP -2.47 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](O)[C@@H](O)[C@@H]1O
|
| ZINC13516910 ZINC | 0.733 | 244.1 Da LogP -2.42 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@@H](CO)[C@@H](O)[C@H]1O
|
| ZINC2562340 ZINC | 0.733 | 244.1 Da LogP -2.42 TPSA 136.7 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O
|
| ZINC4097102 ZINC | 0.719 | 259.2 Da LogP -3.14 TPSA 162.7 | 1 viol. | ✓ Clean |
N[C@H]1[C@H](O)O[C@H](COP(=O)(O)O)[C@@H](O)[C@@…
|
| ZINC4097103 ZINC | 0.719 | 259.2 Da LogP -3.14 TPSA 162.7 | 1 viol. | ✓ Clean |
N[C@H]1[C@@H](O)O[C@H](COP(=O)(O)O)[C@@H](O)[C@…
|
| ZINC12502703 ZINC | 0.667 | 340.1 Da LogP -2.99 TPSA 203.4 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](OP(=O)(O)O)[C@H](O)[C@…
|
| ZINC4095589 ZINC | 0.667 | 340.1 Da LogP -2.99 TPSA 203.4 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](OP(=O)(O)O)[C@H](O)[C@@…
|
| ZINC15298193 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@@H…
|
| ZINC1933262384 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@@H…
|
| ZINC1933262385 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@@H…
|
| ZINC1933262386 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@H]…
|
| ZINC1933262387 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@H]…
|
| ZINC256073272 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@H…
|
| ZINC256073273 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@@…
|
| ZINC256073274 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@H…
|
| ZINC256073275 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](O[C@@H]2O[C@H](CO)[C@@…
|
| ZINC4228300 ZINC | 0.657 | 422.3 Da LogP -5.28 TPSA 236.1 | 2 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](O[C@H]2O[C@H](CO)[C@@H]…
|
| ZINC56870785 ZINC | 0.656 | 228.1 Da LogP -1.40 TPSA 116.5 | ✓ Ro5 | ✓ Clean |
C[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](O)[C@H]1O
|
| ZINC13522068 ZINC | 0.636 | 310.1 Da LogP -2.35 TPSA 183.2 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@H](OP(=O)(O)O)[C@H](O)[C@@…
|
| ZINC3870205 ZINC | 0.636 | 310.1 Da LogP -2.35 TPSA 183.2 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](OP(=O)(O)O)[C@@H](O)[C…
|
| ZINC4095560 ZINC | 0.636 | 310.1 Da LogP -2.35 TPSA 183.2 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H]1O[C@@H](OP(=O)(O)O)[C@H](O)[C@…
|
| ZINC1532601 ZINC | 0.630 | 200.1 Da LogP -1.98 TPSA 124.3 | ✓ Ro5 | ✓ Clean |
O=C[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC32786787 ZINC | 0.630 | 200.1 Da LogP -1.98 TPSA 124.3 | ✓ Ro5 | ✓ Clean |
O=C[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC13513381 ZINC | 0.622 | 301.2 Da LogP -2.12 TPSA 169.3 | 1 viol. | ✓ Clean |
C/C(O)=N/[C@H]1[C@H](O)O[C@H](COP(=O)(O)O)[C@H]…
|
| ZINC30725927 ZINC | 0.622 | 301.2 Da LogP -2.12 TPSA 169.3 | 1 viol. | ✓ Clean |
C/C(O)=N/[C@H]1[C@@H](O)O[C@H](COP(=O)(O)O)[C@H…
|
| ZINC1532625 ZINC | 0.605 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)[C@@H](O)[C@H](COP(=O)(O)O…
|
| ZINC245204467 ZINC | 0.605 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)[C@@H](O)[C@@H](COP(=O)(O)…
|
| ZINC245204468 ZINC | 0.605 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)[C@H](O)[C@@H](COP(=O)(O)O…
|
| ZINC30725207 ZINC | 0.605 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@@H]1[C@H](O)O[C@H](COP(=O)(O)O)[C@@H]…
|
| ZINC4096363 ZINC | 0.605 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@@H]1[C@@H](O)O[C@H](COP(=O)(O)O)[C@@H…
|
| ZINC4097100 ZINC | 0.605 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@@H](O)O[C@H](COP(=O)(O)O)[C@@H]…
|
| ZINC4097101 ZINC | 0.605 | 301.2 Da LogP -2.96 TPSA 165.8 | 1 viol. | ✓ Clean |
CC(=O)N[C@H]1[C@H](O)O[C@H](COP(=O)(O)O)[C@@H](…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.