KpATCC43816 Protein target profile

ATP-dependent DNA helicase RecQ

Accession: VK055_3158

Gene: AIK81730.1 recQ 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GKF3
Length 608
Pocket druggability (P2Rank · AlphaFold DB model) 0.948
Direct ligand evidence 0 78 total records
Functional annotation 1 EC 18 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
55.102 Lower values reduce human off-target concern.
Human E-value
7.66e-13
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
63.744 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
89.39 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.948
Structure A0A0H3GKF3
Pocket Pocket 1
Druggability (FPocket) 0.635
Structure A0A0H3GKF3
Pocket Pocket 10
ColabFold model
P2Rank 0.848 · Pocket 1
FPocket 0.85 · Pocket 4
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 140 / 4744 genomes with a hit
Prevalence 3.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MAQAEVLNQESLAKQVLQETFGYQQFRPGQETIIETALEGRDCLVVMPTGGGKSLCYQVPALVMGGLTVVVSPLISLMKDQVDQLLANGVAAACLNSTQSREQQQEVMAGCRSGQVRLLYIAPERLMLDNFLEHLANWNLAMLAVDEAHCISQWGHDFRPEYAALGQLRQRMPQIPFMALTATADDTTRRDIVRLLGLNDPLIQVSSFDRPNIRYMLMEKFKPLDQLMRYVQDQRGKSGIIYCNSRSKVEDTAARLQSRGISAAAYHAGLENDVRAEVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPAGPLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGNCDICLDPPKQYDGLMDARKALSTIYRVNQRFGMGYVVEVLRGANNQRIREMGHDKLPVYGIGREQSHEHWVSVIRQLIHLGLVTQNIAQHSALQLTEAARPVLRGEVPLQLAVPRIVALKPKAMQKSFGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLIEMAEQSPLTAGEMLSVNGVGTRKLERFGKPFMALIRAHVDGDDE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 18 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

18
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0003676 Binding to a nucleic acid.
  • GO:0006260 The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by the origin recognition complex, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
  • GO:0006310 Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
  • GO:0043138 Unwinding a DNA helix in the direction 5' to 3', driven by ATP hydrolysis.
  • GO:0003678 Unwinding of a DNA helix, driven by ATP hydrolysis.
  • GO:0044237 OBSOLETE. The chemical reactions and pathways by which individual cells transform chemical substances.
  • GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
  • GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
  • GO:0009432 An error-prone process for repairing damaged microbial DNA.
  • GO:0004386 Catalysis of the reaction: ATP + H2O = ADP + phosphate, to drive the unwinding of a DNA or RNA helix.
  • GO:0043590 The region of a bacterial cell to which the DNA is confined.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0030894 A multi-component enzymatic machine at the replication fork which mediates DNA replication. Includes DNA primase, one or more DNA polymerases, DNA helicases, and other proteins.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0009378 Unwinding a DNA helix of DNA containing four-way junctions, including Holliday junctions, driven by ATP hydrolysis.
  • GO:0016787 Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc.
  • GO:0046872 Binding to a metal ion.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

48 records
Show feature table
Start End DB Term Name
209 340 Gene3D G3DSA:3.40.50.300 -
209 340 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
343 404 Pfam PF16124 RecQ zinc-binding
343 404 InterPro IPR032284 ATP-dependent DNA helicase RecQ, zinc-binding domain
14 209 CDD cd17920 DEXHc_RecQ
250 331 SMART SM00490 helicmild6
250 331 InterPro IPR001650 Helicase, C-terminal
411 514 SMART SM00956 RQC_2
411 514 InterPro IPR018982 RQC domain
533 599 Pfam PF00570 HRDC domain
533 599 InterPro IPR002121 HRDC domain
2 208 Gene3D G3DSA:3.40.50.300 -
2 208 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
28 187 Pfam PF00270 DEAD/DEAH box helicase
28 187 InterPro IPR011545 DEAD/DEAH box helicase domain
526 606 FunFam G3DSA:1.10.150.80:FF:000002 ATP-dependent DNA helicase RecQ
13 601 NCBIfam TIGR01389 DNA helicase RecQ
13 601 InterPro IPR006293 DNA helicase, ATP-dependent, RecQ type, bacterial
1 209 FunFam G3DSA:3.40.50.300:FF:000296 ATP-dependent DNA helicase RecQ
34 202 ProSiteProfiles PS51192 Superfamilies 1 and 2 helicase ATP-binding type-1 domain profile.
34 202 InterPro IPR014001 Helicase superfamily 1/2, ATP-binding domain
208 455 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
208 455 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
529 608 SMART SM00341 hrdc7
529 608 InterPro IPR002121 HRDC domain
210 340 CDD cd18794 SF2_C_RecQ
223 371 ProSiteProfiles PS51194 Superfamilies 1 and 2 helicase C-terminal domain profile.
223 371 InterPro IPR001650 Helicase, C-terminal
341 522 Gene3D G3DSA:1.10.10.10 -
341 522 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
13 592 PANTHER PTHR13710 DNA HELICASE RECQ FAMILY MEMBER
15 464 NCBIfam TIGR00614 RecQ family ATP-dependent DNA helicase
15 464 InterPro IPR004589 DNA helicase, ATP-dependent, RecQ type
529 608 ProSiteProfiles PS50967 HRDC domain profile.
8 201 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
8 201 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
341 522 FunFam G3DSA:1.10.10.10:FF:000175 ATP-dependent DNA helicase RecQ
210 340 FunFam G3DSA:3.40.50.300:FF:000156 ATP-dependent DNA helicase recQ
223 330 Pfam PF00271 Helicase conserved C-terminal domain
223 330 InterPro IPR001650 Helicase, C-terminal
523 608 Gene3D G3DSA:1.10.150.80 HRDC domain
523 608 InterPro IPR044876 HRDC domain superfamily
530 605 SUPERFAMILY SSF47819 HRDC-like
530 605 InterPro IPR010997 HRDC-like superfamily
22 218 SMART SM00487 ultradead3
22 218 InterPro IPR014001 Helicase superfamily 1/2, ATP-binding domain
406 514 Pfam PF09382 RQC domain
406 514 InterPro IPR018982 RQC domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.948
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.323
Likely same site as FPocket 10 0.7 Å 19 shared residues 95% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.093
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.088
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.055
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #10
0.635
Likely same site as P2Rank 2 0.7 Å 19 shared residues 95% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GKF3
AlphaFold DB full sequence Viewing
ColabFold VK055_3158
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

78 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 28 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 24 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
6SV PDB via homolog 226.3 Da · LogP 1.80 · TPSA 50.4 Open detail RCSB PDB
AGS PDB via homolog Detail RCSB PDB
ANP PDB via homolog Detail RCSB PDB
EU3 PDB via homolog Detail RCSB PDB
CHEMBL1399702 ChEMBL via homolog · pchembl 8.96 (~1.1 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
6SV RCSB PDB O94762 226.3 Da LogP 1.80 TPSA 50.4 ✓ Ro5 ✓ Clean C1CCC(CC1)NC(=O)NC[C@H]2CCCO2
AGS RCSB PDB P15043 523.2 Da LogP -1.51 TPSA 262.1 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ANP RCSB PDB O01378 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
EU3 RCSB PDB Q14191 152.0 Da LogP 0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Eu+3]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.