Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 92.35 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRISLACLVALCALPAGVMAQDASVHDKPAVRGSIIANLLQDHDNPFLLYPYESNYLLYTWTSDLNKEAIRSYDWAENARKDEVKFQLSLAFPLWRGILGDNSLLGASYTQKSWWQLSNSKESAPFRETNYEPQLFLGFATDYQFAGWTLRDIEMGYNHDSNGRSDPTSRSWNRLYARLMAQNGNWLVEVKPWYVVGNTDDNPDITKYMGYYRLKVGYQLGEAILSAQGQYNWNTGYGGAELGVSYPITKHVRAYTQIYSGYGESLIDYNFNQTRVGVGLMLNDLF
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- OuterMembrane
Gene Ontology (GO)
8- GO:0004620 Catalysis of the hydrolysis of a glycerophospholipid.
- GO:0006629 The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
- GO:0005509 Binding to a calcium ion (Ca2+).
- GO:0008970 Catalysis of the reaction: a 1,2-diacyl-sn-glycero-3-phospholipid + H2O = a 2-acyl-sn-glycero-3-phospholipid + a fatty acid + H+. Note that the substrate has a diacyl group attached to the glycerol group.
- GO:0004623 A glycerophospholipase activity that cleaves the fatty acid attached to the sn-2 position of the glycerol group of a glycerophospholipid. Substrates include phosphatidylcholine, phosphatidylethanolamine, choline plasmalogen and phosphatides.
- GO:0016042 The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 47 | 277 | CDD | cd00541 | OMPLA |
| 47 | 277 | InterPro | IPR003187 | Phospholipase A1 |
| 37 | 285 | SUPERFAMILY | SSF56931 | Outer membrane phospholipase A (OMPLA) |
| 37 | 285 | InterPro | IPR036541 | Phospholipase A1 superfamily |
| 1 | 20 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 153 | 167 | PRINTS | PR01486 | Bacterial phospholipase A1 protein signature |
| 153 | 167 | InterPro | IPR003187 | Phospholipase A1 |
| 123 | 142 | PRINTS | PR01486 | Bacterial phospholipase A1 protein signature |
| 123 | 142 | InterPro | IPR003187 | Phospholipase A1 |
| 233 | 250 | PRINTS | PR01486 | Bacterial phospholipase A1 protein signature |
| 233 | 250 | InterPro | IPR003187 | Phospholipase A1 |
| 100 | 116 | PRINTS | PR01486 | Bacterial phospholipase A1 protein signature |
| 100 | 116 | InterPro | IPR003187 | Phospholipase A1 |
| 200 | 218 | PRINTS | PR01486 | Bacterial phospholipase A1 protein signature |
| 200 | 218 | InterPro | IPR003187 | Phospholipase A1 |
| 168 | 186 | PRINTS | PR01486 | Bacterial phospholipase A1 protein signature |
| 168 | 186 | InterPro | IPR003187 | Phospholipase A1 |
| 255 | 275 | PRINTS | PR01486 | Bacterial phospholipase A1 protein signature |
| 255 | 275 | InterPro | IPR003187 | Phospholipase A1 |
| 78 | 95 | PRINTS | PR01486 | Bacterial phospholipase A1 protein signature |
| 78 | 95 | InterPro | IPR003187 | Phospholipase A1 |
| 30 | 286 | FunFam | G3DSA:2.40.230.10:FF:000001 | Phospholipase A(1) |
| 1 | 20 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 1 | 2 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 22 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 15 | 20 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 24 | 286 | PANTHER | PTHR40457 | PHOSPHOLIPASE A1 |
| 24 | 286 | InterPro | IPR003187 | Phospholipase A1 |
| 21 | 286 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 30 | 286 | Gene3D | G3DSA:2.40.230.10 | Phospholipase A1 |
| 30 | 286 | InterPro | IPR036541 | Phospholipase A1 superfamily |
| 41 | 282 | Pfam | PF02253 | Phospholipase A1 |
| 41 | 282 | InterPro | IPR003187 | Phospholipase A1 |
| 3 | 14 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GGK3
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_3159
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100019805 ZINC | 1.000 | 292.5 Da LogP 4.97 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCS(=O)(=O)O
|
| ZINC1625794 ZINC | 1.000 | 264.4 Da LogP 4.19 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCS(=O)(=O)O
|
| ZINC1651926 ZINC | 1.000 | 250.4 Da LogP 3.80 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCS(=O)(=O)O
|
| ZINC1843748 ZINC | 1.000 | 222.3 Da LogP 3.01 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCS(=O)(=O)O
|
| ZINC2515939 ZINC | 1.000 | 236.4 Da LogP 3.41 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCS(=O)(=O)O
|
| ZINC42921009 ZINC | 1.000 | 278.5 Da LogP 4.58 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCS(=O)(=O)O
|
| ZINC80135680 ZINC | 1.000 | 208.3 Da LogP 2.62 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCS(=O)(=O)O
|
| ZINC5113156 ZINC | 0.722 | 246.3 Da LogP 0.32 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCCCS(=O)(=O)O
|
| ZINC1763010 ZINC | 0.667 | 218.3 Da LogP -0.46 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCS(=O)(=O)O
|
| ZINC14880434 ZINC | 0.654 | 336.6 Da LogP 4.26 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[N+](C)(C)CCCS(=O)(=O)O
|
| ZINC2384686 ZINC | 0.654 | 280.5 Da LogP 2.70 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC[N+](C)(C)CCCS(=O)(=O)O
|
| ZINC58541260 ZINC | 0.654 | 308.5 Da LogP 3.48 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC[N+](C)(C)CCCS(=O)(=O)O
|
| ZINC20231719 ZINC | 0.619 | 234.4 Da LogP 3.56 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CCCCCCS(=O)(=O)CCCCCC
|
| ZINC2166283 ZINC | 0.619 | 262.5 Da LogP 4.34 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CCCCCC
|
| ZINC104242223 ZINC | 0.615 | 322.5 Da LogP 4.59 TPSA 63.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCOCCS(=O)(=O)O
|
| ZINC1589373 ZINC | 0.615 | 238.3 Da LogP 2.25 TPSA 63.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOCCS(=O)(=O)O
|
| ZINC1595574 ZINC | 0.591 | 234.4 Da LogP 3.56 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CCCC
|
| ZINC1595597 ZINC | 0.591 | 220.4 Da LogP 3.17 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCS(C)(=O)=O
|
| ZINC5225211 ZINC | 0.579 | 204.2 Da LogP -0.85 TPSA 108.7 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCS(=O)(=O)O
|
| ZINC1690090 ZINC | 0.571 | 206.4 Da LogP 2.78 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
CCCCCS(=O)(=O)CCCCC
|
| ZINC59471161 ZINC | 0.565 | 265.4 Da LogP 2.73 TPSA 80.4 | ✓ Ro5 | ✓ Clean |
NCCCCCCCCCCCCS(=O)(=O)O
|
| ZINC100310228 ZINC | 0.560 | 334.6 Da LogP 4.87 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCCS(=O)(=O)CCO
|
| ZINC101020164 ZINC | 0.560 | 292.5 Da LogP 3.70 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCS(=O)(=O)CCCO
|
| ZINC1732769 ZINC | 0.560 | 222.3 Da LogP 1.75 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CCO
|
| ZINC98008412 ZINC | 0.560 | 250.4 Da LogP 2.53 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CCCCO
|
| ZINC98008415 ZINC | 0.560 | 236.4 Da LogP 2.14 TPSA 54.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CCCO
|
| ZINC2895764 ZINC | 0.533 | 279.4 Da LogP 2.13 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)NCCS(=O)(=O)O
|
| ZINC59696283 ZINC | 0.533 | 363.6 Da LogP 4.47 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCCC(=O)NCCS(=O)(=O)O
|
| ZINC95669587 ZINC | 0.533 | 308.4 Da LogP 3.34 TPSA 80.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OCCS(=O)(=O)O
|
| ZINC1593660 ZINC | 0.520 | 221.4 Da LogP 2.24 TPSA 37.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)N(C)C
|
| ZINC1602586 ZINC | 0.520 | 207.3 Da LogP 1.90 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)NC
|
| ZINC97977037 ZINC | 0.520 | 278.5 Da LogP 4.27 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCS(=O)(=O)OC
|
| ZINC100311643 ZINC | 0.519 | 292.4 Da LogP 3.41 TPSA 71.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCS(=O)(=O)CC(=O)O
|
| ZINC1583652 ZINC | 0.519 | 264.4 Da LogP 2.63 TPSA 71.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCS(=O)(=O)CC(=O)O
|
| ZINC20519776 ZINC | 0.519 | 208.3 Da LogP 1.07 TPSA 71.4 | ✓ Ro5 | ✓ Clean |
CCCCCCS(=O)(=O)CC(=O)O
|
| ZINC43352221 ZINC | 0.519 | 236.3 Da LogP 1.85 TPSA 71.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CC(=O)O
|
| ZINC116083549 ZINC | 0.517 | 224.3 Da LogP 1.00 TPSA 80.7 | ✓ Ro5 | ✓ Clean |
CCOC(=O)CCCCCS(=O)(=O)O
|
| ZINC100025293 ZINC | 0.516 | 262.4 Da LogP 1.50 TPSA 60.9 | ✓ Ro5 | ✓ Clean |
CCCCN1C=CN(CCCCS(=O)(=O)O)C1
|
| ZINC100304321 ZINC | 0.516 | 349.5 Da LogP 4.03 TPSA 74.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)N(C)CCS(=O)(=O)O
|
| ZINC59684305 ZINC | 0.516 | 321.5 Da LogP 3.25 TPSA 74.7 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)N(C)CCS(=O)(=O)O
|
| ZINC103008613 ZINC | 0.500 | 249.4 Da LogP 3.07 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCNS(=O)(=O)CCC
|
| ZINC1550780 ZINC | 0.500 | 235.3 Da LogP 1.25 TPSA 77.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CC(N)=O
|
| ZINC1602573 ZINC | 0.500 | 222.3 Da LogP 2.71 TPSA 43.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)OCC
|
| ZINC1723787 ZINC | 0.500 | 204.3 Da LogP 2.91 TPSA 34.1 | ✓ Ro5 | ✓ Clean |
C=CS(=O)(=O)CCCCCCCC
|
| ZINC1847701 ZINC | 0.500 | 238.3 Da LogP 2.95 TPSA 63.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCOS(=O)(=O)O
|
| ZINC2004468 ZINC | 0.500 | 224.3 Da LogP 2.56 TPSA 63.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCOS(=O)(=O)O
|
| ZINC2015925 ZINC | 0.500 | 210.3 Da LogP 2.17 TPSA 63.6 | ✓ Ro5 | ✓ Clean |
CCCCCCCCOS(=O)(=O)O
|
| ZINC2865194 ZINC | 0.500 | 221.4 Da LogP 1.72 TPSA 60.2 | ✓ Ro5 | ✓ Clean |
CCCCCCCCS(=O)(=O)CCN
|
| ZINC2895765 ZINC | 0.500 | 223.3 Da LogP 0.57 TPSA 83.5 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)NCCS(=O)(=O)O
|
| ZINC39317991 ZINC | 0.500 | 290.4 Da LogP 0.34 TPSA 118.0 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCOCCCCS(=O)(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.