KpATCC43816 Protein target profile

amino acid permease family protein

Accession: VK055_3179

Gene: AIK81747.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GKD5
Length 461
Pocket druggability (P2Rank · AlphaFold DB model) 0.578
Direct ligand evidence 0 70 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
23.81 Lower values reduce human off-target concern.
Human E-value
1.64e-07
Gut microbiome similarity
4.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
49.02 Higher values support similarity to known essential genes.
DEG E-value
8.23e-161 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
87.1 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.578
Structure A0A0H3GKD5
Pocket Pocket 1
Druggability (FPocket) 0.943
Structure A0A0H3GKD5
Pocket Pocket 19
ColabFold model
P2Rank 0.5 · Pocket 1
FPocket 0.706 · Pocket 20
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 221 / 4744 genomes with a hit
Prevalence 4.7%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTEKKAELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSVLLAYIIAGLFVFFIMRSMGEMLFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFPEMAQWIPALIAVGLVALANLAAVRLYGEIEFWFAMIKVTTIIVMIVVGLGVIFFGFGNGGHSIGFGNLTEHGGFFAGGWKGFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILIFYVGAIFVIVTIFPWDQIGSNGSPFVLTFAKIGITAAAGIINFVVLTAALSGCNSGMYSCGRMLYALAKNRQLPAAIGKVSRNGVPSVGVALSILILLVGSCLNYIIPNPQRVFVYVYSASVLPGMVPWFVILISQLRFRRVHQAAIASHPFRSLLFPWANYFTMAFLICVLVGMGLNDETRMSLFVGIIFLAAVTLIYKVFGLGRQGQVNNTAE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

4
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0006865 The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

45 records
Show feature table
Start End DB Term Name
40 60 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 455 PIRSF PIRSF006060 AA_transporter
7 456 FunFam G3DSA:1.20.1740.10:FF:000001 Amino acid permease
178 196 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
401 423 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
429 448 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
220 239 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
7 457 Gene3D G3DSA:1.20.1740.10 Amino acid/polyamine transporter I
359 380 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
93 115 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
125 147 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
240 259 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
260 270 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
154 176 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
147 157 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
191 213 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
300 333 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
424 428 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
35 39 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
381 400 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
271 299 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
120 124 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
241 263 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
449 461 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
197 219 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
40 59 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
354 358 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
2 455 PANTHER PTHR43495 GABA PERMEASE
94 119 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
331 353 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
428 450 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
334 353 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
125 146 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
158 177 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
12 34 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
278 300 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
41 71 ProSitePatterns PS00218 Amino acid permeases signature.
41 71 InterPro IPR004840 Amino acid permease, conserved site
61 93 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
358 380 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
19 36 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
401 423 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
16 428 Pfam PF00324 Amino acid permease
16 428 InterPro IPR004841 Amino acid permease/ SLC12A domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.578
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.261
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.147
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.058
Likely same site as FPocket 9 1.5 Å 9 shared residues 90% of smaller site
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.026
Likely same site as FPocket 11 0.7 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #19
0.943
Show in viewer
Surrounding area
Pocket 2 FPocket #13
0.567
Show in viewer
Surrounding area
Pocket 3 FPocket #11
0.36
Likely same site as P2Rank 5 0.7 Å 6 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 4 FPocket #9
0.231
Likely same site as P2Rank 4 1.5 Å 9 shared residues 90% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GKD5
AlphaFold DB full sequence Viewing
ColabFold VK055_3179
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

70 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 20 records from similar proteins
Structural ligands 6 0 loaded crystals
Measured bioactivity 14 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
AG2 PDB via homolog 130.2 Da · LogP -0.79 · TPSA 87.9 Open detail RCSB PDB
BNG PDB via homolog Detail RCSB PDB
CLR PDB via homolog Detail RCSB PDB
D10 PDB via homolog Detail RCSB PDB
HEX PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AG2 RCSB PDB P60061 130.2 Da LogP -0.79 TPSA 87.9 ✓ Ro5 ✓ Clean C(CCNC(=N)N)CN
BNG RCSB PDB P60061 306.4 Da LogP 0.55 TPSA 99.4 ✓ Ro5 ✓ Clean CCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1)CO…
CLR RCSB PDB Q5L1G5 386.7 Da LogP 7.39 TPSA 20.2 1 viol. ✓ Clean CC(C)CCC[C@@H](C)[C@H]1CC[C@@H]2[C@@]1(CC[C@H]3…
D10 RCSB PDB P60061 142.3 Da LogP 4.15 TPSA 0.0 ✓ Ro5 ✓ Clean CCCCCCCCCC
HEX RCSB PDB P60061 86.2 Da LogP 2.59 TPSA 0.0 ✓ Ro5 ✓ Clean CCCCCC
OLC RCSB PDB Q5L1G5 356.5 Da LogP 4.92 TPSA 66.8 ✓ Ro5 ✓ Clean CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](CO)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.