KpATCC43816 Protein target profile

ATP synthase F1, delta subunit

Accession: VK055_3333

Gene: atpH AIK81890.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GXU5
Length 177
Pocket druggability (FPocket · AlphaFold DB model) 0.66
Direct ligand evidence 0 5 total records
Functional annotation 0 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
24.118 Lower values reduce human off-target concern.
Human E-value
2.5e-10
Gut microbiome similarity
2.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
88.136 Higher values support similarity to known essential genes.
DEG E-value
6.3099999999999985e-115 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
75.79 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank)
Structure A0A0H3GXU5
Pocket No pockets
Druggability (FPocket) 0.66
Structure A0A0H3GXU5
Pocket Pocket 3
ColabFold model
P2Rank 0.005 · Pocket 1
FPocket 0.676 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 136 / 4744 genomes with a hit
Prevalence 2.9%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSEFVTVARPYAKAAFDFAVEHNSVERWQDMLAFAAEVTKNDQMAELLSGALAPETLSEAFIAICGEQLDENGQNLIKVMAENNRLKVLPDVLEQFIHLRAASEAIAEVEVISANQLSDEQLARIVSAMEKRLSRKVKLNCKIDKSVMAGIIIRAGDMVIDGSVRGRLERLADVLQS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

5
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015986 The chemical reactions and pathways resulting in the formation of ATP driven by transport of protons across a membrane to generate an electrochemical gradient (proton-motive force).
  • GO:0046933 Enables the synthesis of ATP from ADP and phosphate by the transfer of protons from one side of a membrane to the other by a rotational mechanism driven by a gradient according to the reaction: ADP + phosphate + 5 H+(out) => ATP + H2O + 4 H+(in).
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0045259 A proton-transporting two-sector ATPase complex that catalyzes the phosphorylation of ADP to ATP during oxidative phosphorylation. The complex comprises a membrane sector (F0) that carries out proton transport and a cytoplasmic compartment sector (F1) that catalyzes ATP synthesis by a rotational mechanism; the extramembrane sector (containing 3 a and 3 b subunits) is connected via the d-subunit to the membrane sector by several smaller subunits. Within this complex, the g and e subunits and the 9-12 c subunits rotate by consecutive 120 degree angles and perform parts of ATP synthesis. This movement is driven by the hydrogen ion electrochemical potential gradient.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
7 174 Pfam PF00213 ATP synthase delta (OSCP) subunit
7 174 InterPro IPR000711 ATPase, OSCP/delta subunit
137 156 ProSitePatterns PS00389 ATP synthase delta (OSCP) subunit signature.
137 156 InterPro IPR020781 ATPase, OSCP/delta subunit, conserved site
3 104 SUPERFAMILY SSF47928 N-terminal domain of the delta subunit of the F1F0-ATP synthase
3 104 InterPro IPR026015 F1F0 ATP synthase OSCP/delta subunit, N-terminal domain superfamily
2 106 Gene3D G3DSA:1.10.520.20 -
2 106 InterPro IPR026015 F1F0 ATP synthase OSCP/delta subunit, N-terminal domain superfamily
3 177 Hamap MF_01416 ATP synthase subunit delta [atpD].
3 177 InterPro IPR000711 ATPase, OSCP/delta subunit
74 85 PRINTS PR00125 ATP synthase delta subunit signature
74 85 InterPro IPR000711 ATPase, OSCP/delta subunit
85 99 PRINTS PR00125 ATP synthase delta subunit signature
85 99 InterPro IPR000711 ATPase, OSCP/delta subunit
7 26 PRINTS PR00125 ATP synthase delta subunit signature
7 26 InterPro IPR000711 ATPase, OSCP/delta subunit
150 168 PRINTS PR00125 ATP synthase delta subunit signature
150 168 InterPro IPR000711 ATPase, OSCP/delta subunit
135 150 PRINTS PR00125 ATP synthase delta subunit signature
135 150 InterPro IPR000711 ATPase, OSCP/delta subunit
6 176 PANTHER PTHR11910 ATP SYNTHASE DELTA CHAIN
6 176 InterPro IPR000711 ATPase, OSCP/delta subunit
2 106 FunFam G3DSA:1.10.520.20:FF:000001 ATP synthase subunit delta
7 175 NCBIfam TIGR01145 ATP synthase F1 subunit delta
7 175 InterPro IPR000711 ATPase, OSCP/delta subunit

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.66
Show in viewer
Surrounding area
Pocket 2 FPocket #7
0.444
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GXU5
AlphaFold DB full sequence Viewing
ColabFold VK055_3333
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

5 records
Chemistry signal

Bioactivity evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 0 0 loaded crystals
Measured bioactivity 1 direct and transferred ChEMBL records
Proposed compounds 4 similarity-based ZINC candidates
Best available ligand signal
DWT ChEMBL via homolog pchembl 7.69 (~20.4 nM) 503.5 Da · LogP 5.75 · TPSA 97.6 Open detail ChEMBL
ZINC220133900 ZINC proposed compound · Tanimoto 0.538 Detail ZINC
ZINC20148987 ZINC proposed compound · Tanimoto 0.532 Detail ZINC
ZINC9306398 ZINC proposed compound · Tanimoto 0.512 Detail ZINC
ZINC5049572 ZINC proposed compound · Tanimoto 0.507 Detail ZINC

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

Show only:
Ligand UniProt (homolog) pchembl MW · LogP · TPSA Lipinski PAINS SMILES
DWT ChEMBL P48047 7.69 ~20.4 nM 503.5 Da LogP 5.75 TPSA 97.6 2 viol. ✓ Clean Cc1ccc(cc1Nc2c3cn(nc3nc(n2)c4cccnc4)C)C(=O)Nc5c…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.