KpATCC43816 Protein target profile

ferredoxin-NADP reductase

Accession: VK055_3466

Gene: AIK82022.1 fpr 3D evidence: Experimental + ColabFold model Metabolism Not in network UniProt A0A0G3NED2
Length 248
Pocket druggability (P2Rank · Experimental) 0.907
Direct ligand evidence 0 13 total records
Functional annotation 2 EC 7 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
39.912 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.9 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.907
Structure 8DOS
Pocket Pocket 1
Druggability (FPocket) 0.943
Structure 8DOS
Pocket Pocket 1
ColabFold model
P2Rank 0.788 · Pocket 1
FPocket 0.17 · Pocket 16
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 113 / 4744 genomes with a hit
Prevalence 2.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MADWVSGKVTKVEYWTDALFSLYVRAPVHPFTAGQFTKLGLEIDGERVQRAYSYVNAPGNPDLEFYLVTVPEGKLSPRLAALKPGDEVLVVSEAAGFFVLEEVPDCDTLWMLATGTALGPYLSILQEGKDLERFNNLVLVHAVRYAADLSYLPLMRELEQRYAGKLRIQTVVSRETVEGSLTGRVPFLIETGALEEAVGLPMTTDTSHVMLCGNPQMVRDTQQLLKETRQMTKHLRRRPGHMTAEHYW

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 EC 7 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

2

Gene Ontology (GO)

7
  • GO:0004324 Catalysis of the reaction: 2 reduced [2Fe-2S]-[ferredoxin] + NADP+ + H+ = 2 oxidized [2Fe-2S]-[ferredoxin] + NADPH.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0046872 Binding to a metal ion.
  • GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
  • GO:0034599 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
  • GO:0042167 The chemical reactions and pathways resulting in the breakdown of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
2 101 ProSiteProfiles PS51384 Ferredoxin reductase-type FAD binding domain profile.
2 101 InterPro IPR017927 FAD-binding domain, ferredoxin reductase-type
1 248 PANTHER PTHR47878 OXIDOREDUCTASE FAD/NAD(P)-BINDING DOMAIN PROTEIN
1 96 FunFam G3DSA:2.40.30.10:FF:000044 Ferredoxin--NADP(+) reductase
8 247 CDD cd06195 FNR1
8 247 InterPro IPR033892 Ferredoxin--NADP reductase, bacteria
97 248 Gene3D G3DSA:3.40.50.80 -
97 248 InterPro IPR039261 Ferredoxin-NADP reductase (FNR), nucleotide-binding domain
20 88 Pfam PF00970 Oxidoreductase FAD-binding domain
20 88 InterPro IPR008333 Flavoprotein pyridine nucleotide cytochrome reductase-like, FAD-binding domain
3 100 SUPERFAMILY SSF63380 Riboflavin synthase domain-like
3 100 InterPro IPR017938 Riboflavin synthase-like beta-barrel
97 248 FunFam G3DSA:3.40.50.80:FF:000013 Ferredoxin--NADP(+) reductase
104 248 SUPERFAMILY SSF52343 Ferredoxin reductase-like, C-terminal NADP-linked domain
104 248 InterPro IPR039261 Ferredoxin-NADP reductase (FNR), nucleotide-binding domain
1 96 Gene3D G3DSA:2.40.30.10 Translation factors
111 222 Pfam PF00175 Oxidoreductase NAD-binding domain
111 222 InterPro IPR001433 Oxidoreductase FAD/NAD(P)-binding

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.907
Likely same site as FPocket 1 7.4 Å 21 shared residues 72% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.062
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.005
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.005
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.943 Unusual size
Likely same site as P2Rank 1 7.4 Å 21 shared residues 72% of smaller site
Show in viewer
Surrounding area
All structural evidence 1 experimental · 1 predicted

Structural evidence

1 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 8DOS
X-ray 1.87 Å A,B
100.0% 1-248
Viewing
ColabFold VK055_3466
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

13 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 11 similarity-based ZINC candidates
Best available ligand signal
FDA PDB via homolog 787.6 Da · LogP -1.75 · TPSA 363.3 Open detail RCSB PDB
FES PDB via homolog Detail RCSB PDB
ZINC12360002 ZINC proposed compound · Tanimoto 0.522 Detail ZINC
ZINC12360703 ZINC proposed compound · Tanimoto 0.522 Detail ZINC
ZINC12503599 ZINC proposed compound · Tanimoto 0.522 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
FDA RCSB PDB P22868 787.6 Da LogP -1.75 TPSA 363.3 3 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=C(N2)C(=O)NC(=O)N3)C[C@@H]([C…
FES RCSB PDB P22868 175.8 Da LogP 1.29 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]S[Fe]1

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Structure