Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 4.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 33.171 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 93.28 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLLHVLYLIGITAEAMTGALAAGRRRMDTFGVIIIATATALGGGSVRDILLGHYPLGWVKHPEYVIIVAVAAVLTTIAAPVMPHLRRLFLVLDALGLIVFSIIGAQIALDMGEGPVIASIAAVITGVFGGVLRDMFCKRIPLVFQKELYAGISFAAAVLYIALQHYVSSHDVVVLATLLFGFTARMLALRWKLGLPVFHYTHDAH
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
1- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 172 | 189 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 172 | 189 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 64 | 81 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 24 | 29 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 64 | 81 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 115 | 136 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 190 | 205 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 30 | 52 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 6 | 23 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 167 | 171 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 29 | 51 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 5 | 22 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 148 | 167 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 53 | 63 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 82 | 87 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 114 | 136 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 88 | 109 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 88 | 109 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 5 | 78 | Pfam | PF03458 | Glycine transporter |
| 5 | 78 | InterPro | IPR005115 | Glycine transporter |
| 91 | 164 | Pfam | PF03458 | Glycine transporter |
| 91 | 164 | InterPro | IPR005115 | Glycine transporter |
| 110 | 114 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 148 | 166 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 137 | 147 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 1 | 203 | PANTHER | PTHR30506 | INNER MEMBRANE PROTEIN |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GXF0
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_3474
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| PX4 RCSB PDB | Q3HKN0 | 679.0 Da LogP 9.68 TPSA 108.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](…
|
|
| TGL RCSB PDB | Q981D4 | 891.5 Da LogP 18.77 TPSA 78.9 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OCC(COC(=O)CCCCCCCCCCCCCC…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC13544781 ZINC | 1.000 | 482.6 Da LogP 4.22 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@@H](CO[P@](=O)(O)OCC[N+](C)(C)C…
|
| ZINC13544783 ZINC | 1.000 | 482.6 Da LogP 4.22 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)…
|
| ZINC13543439 ZINC | 0.977 | 454.5 Da LogP 3.44 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO[P@](=O)(O)OCC[N+](C)(C)C)…
|
| ZINC13543441 ZINC | 0.977 | 454.5 Da LogP 3.44 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)O…
|
| ZINC4521879 ZINC | 0.963 | 386.5 Da LogP 4.73 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OCC(COC(=O)CCCCC)OC(=O)CCCCC
|
| ZINC33822387 ZINC | 0.911 | 426.5 Da LogP 2.66 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCC[N+](C)(C)C)O…
|
| ZINC33822389 ZINC | 0.911 | 426.5 Da LogP 2.66 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCC[N+](C)(C)C)…
|
| ZINC4521911 ZINC | 0.857 | 344.4 Da LogP 3.56 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCC(=O)OCC(COC(=O)CCCC)OC(=O)CCCC
|
| ZINC36079847 ZINC | 0.839 | 344.5 Da LogP 4.15 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO)OC(=O)CCCCCCC
|
| ZINC8214428 ZINC | 0.839 | 344.5 Da LogP 4.15 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO)OC(=O)CCCCCCC
|
| ZINC12834352 ZINC | 0.826 | 398.4 Da LogP 1.88 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCC(=O)OC[C@@H](CO[P@](=O)(O)OCC[N+](C)(C)C)OC…
|
| ZINC12834353 ZINC | 0.826 | 398.4 Da LogP 1.88 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)OC(…
|
| ZINC103659671 ZINC | 0.806 | 358.5 Da LogP 3.95 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC(COC(C)=O)COC(C)=O
|
| ZINC5820130 ZINC | 0.806 | 288.4 Da LogP 2.59 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO)OC(=O)CCCCC
|
| ZINC5820133 ZINC | 0.806 | 288.4 Da LogP 2.59 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO)OC(=O)CCCCC
|
| ZINC27646150 ZINC | 0.781 | 274.4 Da LogP 2.20 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO)OC(=O)CCCC
|
| ZINC36178999 ZINC | 0.771 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC36179002 ZINC | 0.771 | 424.5 Da LogP 4.27 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCCCC
|
| ZINC102190506 ZINC | 0.771 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCCN)OC(=O)CC…
|
| ZINC102190512 ZINC | 0.771 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)C…
|
| ZINC85480136 ZINC | 0.758 | 358.5 Da LogP 3.95 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC[C@@H](COC(C)=O)OC(C)=O
|
| ZINC85480138 ZINC | 0.758 | 358.5 Da LogP 3.95 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC[C@H](COC(C)=O)OC(C)=O
|
| ZINC85480140 ZINC | 0.758 | 386.5 Da LogP 4.73 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](COC(C)=O)OC(C)=O
|
| ZINC85480143 ZINC | 0.758 | 386.5 Da LogP 4.73 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](COC(C)=O)OC(C)=O
|
| ZINC102189757 ZINC | 0.755 | 454.6 Da LogP 4.04 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OCC[N+…
|
| ZINC13544128 ZINC | 0.755 | 370.4 Da LogP 1.70 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCC(=O)OC[C@@H](O)CO[P@](=O)(O)OCC[N+](C)(C…
|
| ZINC14880038 ZINC | 0.755 | 440.5 Da LogP 3.65 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@](=O)(O)OCC[N+]…
|
| ZINC14880039 ZINC | 0.755 | 440.5 Da LogP 3.65 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC(=O)OC[C@H](O)CO[P@@](=O)(O)OCC[N+]…
|
| ZINC15297567 ZINC | 0.755 | 468.6 Da LogP 4.43 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OCC[…
|
| ZINC32789157 ZINC | 0.755 | 412.5 Da LogP 2.87 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)OC[C@@H](O)CO[P@](=O)(O)OCC[N+](C…
|
| ZINC32789161 ZINC | 0.755 | 412.5 Da LogP 2.87 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)OC[C@H](O)CO[P@](=O)(O)OCC[N+](C)…
|
| ZINC32822149 ZINC | 0.755 | 468.6 Da LogP 4.43 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@](=O)(O)OCC[N+…
|
| ZINC32822162 ZINC | 0.755 | 482.6 Da LogP 4.82 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OCC…
|
| ZINC32822163 ZINC | 0.755 | 482.6 Da LogP 4.82 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCCC(=O)OC[C@H](O)CO[P@](=O)(O)OCC[N…
|
| ZINC44305349 ZINC | 0.755 | 454.6 Da LogP 4.04 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OCC[N…
|
| ZINC44405718 ZINC | 0.755 | 398.5 Da LogP 2.48 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OCC[N+](C…
|
| ZINC44405722 ZINC | 0.755 | 426.5 Da LogP 3.26 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OCC[N+]…
|
| ZINC85576534 ZINC | 0.755 | 384.4 Da LogP 2.09 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](O)CO[P@@](=O)(O)OCC[N+](C)…
|
| ZINC27416437 ZINC | 0.750 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCCN)OC(=O)CCCCC
|
| ZINC33902364 ZINC | 0.750 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)CCC…
|
| ZINC5820131 ZINC | 0.743 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC5820134 ZINC | 0.743 | 368.4 Da LogP 2.71 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](COP(=O)(O)O)OC(=O)CCCCC
|
| ZINC13507210 ZINC | 0.735 | 356.4 Da LogP 1.31 TPSA 102.3 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](O)CO[P@](=O)(O)OCC[N+](C)(C)C
|
| ZINC3860906 ZINC | 0.724 | 302.4 Da LogP 2.38 TPSA 78.9 | ✓ Ro5 | ✓ Clean |
CCCC(=O)OCC(COC(=O)CCC)OC(=O)CCC
|
| ZINC1608739 ZINC | 0.710 | 228.4 Da LogP 4.33 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OCC(CC)CC
|
| ZINC13508374 ZINC | 0.708 | 370.4 Da LogP 1.10 TPSA 108.4 | ✓ Ro5 | ✓ Clean |
CCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](C)(C)C)OC(=…
|
| ZINC102191119 ZINC | 0.686 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@@H](O)CO…
|
| ZINC58649551 ZINC | 0.686 | 498.6 Da LogP 3.65 TPSA 148.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OC[C@H](O)CO)…
|
| ZINC2522769 ZINC | 0.677 | 228.4 Da LogP 4.33 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC(=O)OCC(C)C
|
| ZINC85809177 ZINC | 0.677 | 218.3 Da LogP 1.24 TPSA 66.8 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC(CO)CO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.