KpATCC43816 Protein target profile

signal recognition particle-docking protein FtsY

Accession: VK055_3640

Gene: AIK82195.1 ftsY 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GYJ7
Length 507
Pocket druggability (P2Rank · AlphaFold DB model) 0.129
Direct ligand evidence 0 59 total records
Functional annotation 1 EC 8 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
34.975 Lower values reduce human off-target concern.
Human E-value
1.41e-31
Gut microbiome similarity
1.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
83.333 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
72.29 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.129
Structure A0A0H3GYJ7
Pocket Pocket 1
Druggability (FPocket) 0.076
Structure A0A0H3GYJ7
Pocket Pocket 32
ColabFold model
P2Rank 0.192 · Pocket 1
FPocket 0.277 · Pocket 8
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 65 / 4744 genomes with a hit
Prevalence 1.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MAKEKKRGFFSWLGFGQKEQAQETETEQKVEEQQAVAEEIPAVETPAEPSAPKADPEAFAEDVVEVTETVVESEKAHLAEPASAQEEEWVETPALTEETPVVEPEPAVSEPPEQPAVVEPLVEEVIAEPVVAEAVAEQPVEGIVVQPQETEAPEEDAPLSDEELEAQALAAEAAEEAAVVVPAPEDEAPLEALAQEQEKPTKEGFFARLKRSLLKTKQNLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARHVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVDAPHEVMLTIDASTGQNAISQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFNAGDFIEALFARED

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 8 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

8
  • GO:0005525 Binding to GTP, guanosine triphosphate.
  • GO:0016887 Catalysis of the reaction: ATP + H2O = ADP + H+ phosphate. ATP hydrolysis is used in some reactions as an energy source, for example to catalyze a reaction or drive transport against a concentration gradient.
  • GO:0006614 The targeting of proteins to a membrane that occurs during translation and is dependent upon two key components, the signal-recognition particle (SRP) and the SRP receptor. SRP is a cytosolic particle that transiently binds to the endoplasmic reticulum (ER) signal sequence in a nascent protein, to the large ribosomal unit, and to the SRP receptor in the ER membrane.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0003924 Catalysis of the reaction: GTP + H2O = GDP + H+ + phosphate.
  • GO:0005047 Binding to a signal recognition particle.
  • GO:0051301 The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

35 records
Show feature table
Start End DB Term Name
232 504 Hamap MF_00920 Signal recognition particle receptor FtsY [ftsY].
232 504 InterPro IPR004390 Signal-recognition particle receptor FtsY
209 289 SMART SM00963 SRP54_N_2
209 289 InterPro IPR013822 Signal recognition particle SRP54, helical bundle
8 16 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
220 285 Pfam PF02881 SRP54-type protein, helical bundle domain
220 285 InterPro IPR013822 Signal recognition particle SRP54, helical bundle
304 502 CDD cd17874 FtsY
295 507 Gene3D G3DSA:3.40.50.300 -
295 507 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
193 293 Gene3D G3DSA:1.20.120.140 -
193 293 InterPro IPR042101 Signal recognition particle SRP54, N-terminal domain superfamily
1 7 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
68 84 MobiDBLite mobidb-lite consensus disorder prediction
302 493 SMART SM00382 AAA_5
302 493 InterPro IPR003593 AAA+ ATPase domain
6 503 PANTHER PTHR43134 SIGNAL RECOGNITION PARTICLE RECEPTOR SUBUNIT ALPHA
199 293 FunFam G3DSA:1.20.120.140:FF:000002 Signal recognition particle receptor FtsY
1 116 MobiDBLite mobidb-lite consensus disorder prediction
477 490 ProSitePatterns PS00300 SRP54-type proteins GTP-binding domain signature.
477 490 InterPro IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain
296 504 FunFam G3DSA:3.40.50.300:FF:000053 Signal recognition particle receptor FtsY
204 283 SUPERFAMILY SSF47364 Domain of the SRP/SRP receptor G-proteins
204 283 InterPro IPR036225 SRP/SRP receptor, N-terminal
22 507 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
296 503 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
296 503 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
303 504 SMART SM00962 SRP54_3
303 504 InterPro IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain
17 21 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
303 503 Pfam PF00448 SRP54-type protein, GTPase domain
303 503 InterPro IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain
232 503 NCBIfam TIGR00064 signal recognition particle-docking protein FtsY
232 503 InterPro IPR004390 Signal-recognition particle receptor FtsY
1 21 Phobius SIGNAL_PEPTIDE Signal peptide region

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.129
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.118
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.075
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.001
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:310-317
UniProt: Binding site:392-396
UniProt: Binding site:456-459
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GYJ7
AlphaFold DB full sequence Viewing
ColabFold VK055_3640
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 9 records from similar proteins
Structural ligands 9 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
0O2 PDB via homolog 683.1 Da · LogP -2.10 · TPSA 392.2 Open detail RCSB PDB
4ME PDB via homolog Detail RCSB PDB
ALF PDB via homolog Detail RCSB PDB
F9Y PDB via homolog Detail RCSB PDB
GCP PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
0O2 RCSB PDB P10121 683.1 Da LogP -2.10 TPSA 392.2 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)(O…
4ME RCSB PDB P10121 175.2 Da LogP 1.95 TPSA 42.1 ✓ Ro5 ✓ Clean COC(=O)c1cccc2c1cc[nH]2
ALF RCSB PDB P10121 103.0 Da LogP 1.30 TPSA 0.0 ✓ Ro5 ✓ Clean F[Al-](F)(F)F
F9Y RCSB PDB P10121 142.2 Da LogP 2.04 TPSA 39.6 ✓ Ro5 ✓ Clean c1cc(cc2c1cc[nH]2)C#N
GCP RCSB PDB O80842 521.2 Da LogP -2.22 TPSA 289.9 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
GNP RCSB PDB P10121 522.2 Da LogP -2.76 TPSA 301.9 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
GXY RCSB PDB P10121 232.1 Da LogP 2.05 TPSA 44.5 ✓ Ro5 ✓ Clean COc1cc(c(cc1Br)OC)N
MLI RCSB PDB O80842 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
NH4 RCSB PDB P10121 18.0 Da LogP 0.38 TPSA 36.5 ✓ Ro5 ✓ Clean [NH4+]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.