KpATCC43816 Protein target profile

rhomboid family protease GlpG

Accession: VK055_3681

Gene: AIK82236.1 glpG 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GUB5
Length 276
Pocket druggability (P2Rank · AlphaFold DB model) 0.921
Direct ligand evidence 0 59 total records
Functional annotation 1 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
36.723 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
87.59 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.921
Structure A0A0H3GUB5
Pocket Pocket 1
Druggability (FPocket) 0.922
Structure A0A0H3GUB5
Pocket Pocket 7
ColabFold model
P2Rank 0.924 · Pocket 1
FPocket 0.87 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 102 / 4744 genomes with a hit
Prevalence 2.2%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MLMITSFANPRVAQAFVDYMATQGIILTIQQHTQSDVWLADESQAGRVRAELARFLENPADQRYLAASWQSGQTNSGLRYQRFPFFATLRHNAGPFTWAILLICIAVFILQNLLGDQPVMIWLAWPYDPSLQFEAWRYFSHAFMHFSLMHILFNLLWWWYLGGAVEKRIGSGKLVVITVISALLSGFVQHQFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLILFSLVWLIAGWFDVFGMAIANGAHVAGLATGLAMAFVDTLHGRKRA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Subcellular localization

Localization
CytoplasmicMembrane

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0004252 Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
  • GO:0006508 The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

35 records
Show feature table
Start End DB Term Name
92 267 SUPERFAMILY SSF144091 Rhomboid-like
92 267 InterPro IPR035952 Rhomboid-like superfamily
196 213 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
161 171 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
248 267 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
143 162 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
225 242 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
191 195 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
96 115 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
214 224 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 67 FunFam G3DSA:3.30.70.2350:FF:000001 Rhomboid protease GlpG
268 276 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
169 188 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
135 160 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
94 266 PANTHER PTHR43066 RHOMBOID-RELATED PROTEIN
91 271 FunFam G3DSA:1.20.1540.10:FF:000003 Rhomboid protease GlpG
92 271 Gene3D G3DSA:1.20.1540.10 -
92 271 InterPro IPR035952 Rhomboid-like superfamily
92 114 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
193 215 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
243 247 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
228 250 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 82 Pfam PF12122 Cytoplasmic N-terminal domain of rhomboid serine protease
1 82 InterPro IPR022732 Peptidase S54, GlpG peptidase, N-terminal
116 134 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
4 270 NCBIfam TIGR04239 rhomboid family intramembrane serine protease GlpG
4 270 InterPro IPR023662 Rhomboid protease GlpG
1 95 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
132 267 Pfam PF01694 Rhomboid family
132 267 InterPro IPR022764 Peptidase S54, rhomboid domain
1 274 Hamap MF_01594 Rhomboid protease GlpG [glpG].
1 274 InterPro IPR023662 Rhomboid protease GlpG
172 190 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 67 Gene3D G3DSA:3.30.70.2350 -
1 67 InterPro IPR038236 GlpG peptidase, N-terminal domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.921
Likely same site as FPocket 7 0.8 Å 23 shared residues 96% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.19
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.15
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.079
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #7
0.922 Unusual size
Likely same site as P2Rank 1 0.8 Å 23 shared residues 96% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:201-201 Nucleophile
UniProt: Active site:254-254
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GUB5
AlphaFold DB full sequence Viewing
ColabFold VK055_3681
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 9 records from similar proteins
Structural ligands 9 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
B2A PDB via homolog 88.9 Da · LogP -1.65 · TPSA 66.5 Open detail RCSB PDB
DFP PDB via homolog Detail RCSB PDB
LDA PDB via homolog Detail RCSB PDB
LMT PDB via homolog Detail RCSB PDB
MC3 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
B2A RCSB PDB P09391 88.9 Da LogP -1.65 TPSA 66.5 ✓ Ro5 ✓ Clean B([C@H](C)N)(O)O
DFP RCSB PDB P09391 166.2 Da LogP 2.23 TPSA 35.5 ✓ Ro5 ✓ Clean CC(C)OP(=O)OC(C)C
LDA RCSB PDB P09391 229.4 Da LogP 4.48 TPSA 23.1 ✓ Ro5 ✓ Clean CCCCCCCCCCCC[N+](C)(C)[O-]
LMT RCSB PDB P09391 510.6 Da LogP -0.45 TPSA 178.5 3 viol. ✓ Clean CCCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1…
MC3 RCSB PDB P09391 677.9 Da LogP 9.05 TPSA 111.2 2 viol. ✓ Clean CCCCCCCCCCCCCC(=O)OC[C@H](CO[P@@](=O)([O-])OCC[…
PA6 RCSB PDB P44783 284.2 Da LogP 0.37 TPSA 119.4 ✓ Ro5 ✓ Clean CCCCC(=O)OC[C@H](COP(=O)(O)O)OC=O
PGV RCSB PDB P09391 749.0 Da LogP 10.45 TPSA 148.8 2 viol. ✓ Clean CCCCCCCCCCCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OC[C@H…
PQE RCSB PDB P44783 536.8 Da LogP 5.19 TPSA 84.8 2 viol. ✓ Clean CCCCCCCCCCCCOCCOCCOCCOCCOCCCCCOCCOCCO
V87 RCSB PDB P09391 177.2 Da LogP 1.76 TPSA 29.1 ✓ Ro5 ✓ Clean c1ccc(cc1)CCCCNC=O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.