KpATCC43816 Protein target profile

sulfoxide reductase catalytic subunit yedY

Accession: VK055_3815

Gene: AIK82365.1 yedY 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GZ50
Length 333
Pocket druggability (P2Rank · AlphaFold DB model) 0.899
Direct ligand evidence 0 5 total records
Functional annotation 1 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
88.73 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.899
Structure A0A0H3GZ50
Pocket Pocket 1
Druggability (FPocket) 0.949
Structure A0A0H3GZ50
Pocket Pocket 1
ColabFold model
P2Rank 0.919 · Pocket 1
FPocket 0.905 · Pocket 5
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 140 / 4744 genomes with a hit
Prevalence 3.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MKRKKLTEADVTAESVFMLKRRQVLKMLGISATALSLPAAAQADLLDWFKGHDRPPAPAGKALEFAKPAEWQANLTLTPEDKVAGYNNFYEFGLDKADPAANAGSLRTDPWTLTIGGEVAKPLTLDHDDLTKRFPLEERIYRMRCVEAWSMVVPWVGFPLHKLLALVEPTSSARYVAFKTLYAPDQMPGQKDRFIGGGLAYPYVEGLRLDEAMHPLTLLTVGVYGKALPPQNGAPVRLTVPWKYGFKGIKSIVSIELTRERPPTTWNLAAPDEYGFFANVNPHVDHPRWSQASERFIGAGGVLDVKRQPTLLFNGYADEVASLYRGMNLRENF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Subcellular localization

Localization
Periplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0030091 The process of restoring a protein to its original state after damage by such things as oxidation or spontaneous decomposition of residues.
  • GO:0016667 Catalysis of an oxidation-reduction (redox) reaction in which a sulfur-containing group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
  • GO:0043546 Binding to a molybdopterin cofactor (Moco), essential for the catalytic activity of some enzymes, e.g. sulfite oxidase, xanthine dehydrogenase, and aldehyde oxidase. The cofactor consists of a mononuclear molybdenum (Mo-molybdopterin) or tungsten ion (W-molybdopterin) coordinated by one or two molybdopterin ligands.
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
  • GO:0046872 Binding to a metal ion.
  • GO:0016672 Catalysis of an oxidation-reduction (redox) reaction in which a sulfur-containing group acts as a hydrogen or electron donor and reduces quinone or a related compound.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
108 266 Pfam PF00174 Oxidoreductase molybdopterin binding domain
108 266 InterPro IPR000572 Oxidoreductase, molybdopterin-binding domain
1 27 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 43 ProSiteProfiles PS51318 Twin arginine translocation (Tat) signal profile.
1 43 InterPro IPR006311 Twin-arginine translocation pathway, signal sequence
4 333 Hamap MF_01206 Protein-methionine-sulfoxide reductase catalytic subunit MsrP [msrP].
4 333 InterPro IPR022867 Protein-methionine-sulfoxide reductase subunit MsrP
84 301 CDD cd02107 YedY_like_Moco
1 43 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
44 333 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
8 328 PANTHER PTHR43032 PROTEIN-METHIONINE-SULFOXIDE REDUCTASE
28 37 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 43 Phobius SIGNAL_PEPTIDE Signal peptide region
38 43 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
75 329 SUPERFAMILY SSF56524 Oxidoreductase molybdopterin-binding domain
75 329 InterPro IPR036374 Oxidoreductase, molybdopterin-binding domain superfamily
63 333 Gene3D G3DSA:3.90.420.10 -
63 333 InterPro IPR036374 Oxidoreductase, molybdopterin-binding domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.899
Likely same site as FPocket 1 0.4 Å 30 shared residues 94% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.323
Likely same site as FPocket 11 4.8 Å 9 shared residues 90% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.322
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.181
Likely same site as FPocket 11 3.1 Å 15 shared residues 94% of smaller site
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.017
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.949 Unusual size
Likely same site as P2Rank 1 0.4 Å 30 shared residues 94% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #18
0.589
Show in viewer
Surrounding area
Pocket 3 FPocket #11
0.407
Likely same site as P2Rank 4 3.1 Å 15 shared residues 94% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:145-145
UniProt: Binding site:180-180
UniProt: Binding site:232-232
UniProt: Binding site:237-237
UniProt: Binding site:248-250
UniProt: Binding site:87-87
UniProt: Binding site:90-91
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GZ50
AlphaFold DB full sequence Viewing
ColabFold VK055_3815
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

5 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 5 records from similar proteins
Structural ligands 5 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 0 similarity-based ZINC candidates
Best available ligand signal
MO PDB via homolog 95.9 Da · LogP -0.00 · TPSA 0.0 Open detail RCSB PDB
MSS PDB via homolog Detail RCSB PDB
MTE PDB via homolog Detail RCSB PDB
O PDB via homolog Detail RCSB PDB
W PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
MO RCSB PDB P76342 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo]
MSS RCSB PDB Q9LA16 505.3 Da LogP -0.12 TPSA 188.9 3 viol. ✓ Clean C([C@@H]1C2=C([C@H]3[C@@H](O1)NC4=C(N3)C(=O)NC(…
MTE RCSB PDB P76342 395.4 Da LogP -0.54 TPSA 171.8 1 viol. ✓ Clean C([C@@H]1C(=C([C@H]2[C@@H](O1)NC3=C(N2)C(=O)NC(…
O RCSB PDB P76342 18.0 Da LogP -0.82 TPSA 31.5 ✓ Ro5 ✓ Clean O
W RCSB PDB P76342 183.8 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [W+6]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.