KpATCC43816 Protein target profile

general stress protein 18

Accession: VK055_3917

Gene: AIK82466.1 yfkM 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GYV3
Length 178
Pocket druggability (P2Rank · AlphaFold DB model) 0.061
Direct ligand evidence 0 104 total records
Functional annotation 0 EC 0 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
27.848 Lower values reduce human off-target concern.
Human E-value
2.99e-06
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.25 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.061
Structure A0A0H3GYV3
Pocket Pocket 1
Druggability (FPocket) 0.627
Structure A0A0H3GYV3
Pocket Pocket 2
ColabFold model
P2Rank 0.131 · Pocket 1
FPocket 0.333 · Pocket 8
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 116 / 4744 genomes with a hit
Prevalence 2.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MSKKIAVLITDDFEDSEFTSPAEAFKLAGHQVITIEKQAGKTVKGKQGEAEVAIDRAIDDVTPGEFDALLLPGGYSPDQLRGDERFVTFTRDFVNGGKPVFAICHGPQLLISADVIRGRKLTAVKPIVVDVKNAGGEFYDQEVVVDNEQLVTSRTPDDLPAFNREALRLLGAGITPPV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

Subcellular localization

Localization
Cytoplasmic

No GO or EC annotations are currently loaded for this protein.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
3 167 Pfam PF01965 DJ-1/PfpI family
3 167 InterPro IPR002818 DJ-1/PfpI
1 172 Gene3D G3DSA:3.40.50.880 -
1 172 InterPro IPR029062 Class I glutamine amidotransferase-like
1 170 SUPERFAMILY SSF52317 Class I glutamine amidotransferase-like
1 170 InterPro IPR029062 Class I glutamine amidotransferase-like
7 178 ProSiteProfiles PS51273 Glutamine amidotransferase type 1 domain profile.
1 172 FunFam G3DSA:3.40.50.880:FF:000017 Type 1 glutamine amidotransferase
3 171 ProSiteProfiles PS51276 PfpI endopeptidase domain profile.
3 171 InterPro IPR006286 Deglycase PfpI-like
4 171 NCBIfam TIGR01382 DJ-1/PfpI/YhbO family deglycase/protease
4 171 InterPro IPR006286 Deglycase PfpI-like
4 169 CDD cd03134 GATase1_PfpI_like
2 172 PANTHER PTHR42733 DJ-1 PROTEIN
2 172 InterPro IPR006286 Deglycase PfpI-like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.061
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.627
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GYV3
AlphaFold DB full sequence Viewing
ColabFold VK055_3917
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

104 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 54 records from similar proteins
Structural ligands 16 0 loaded crystals
Measured bioactivity 38 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
2HA PDB via homolog 90.1 Da · LogP -1.46 · TPSA 57.5 Open detail RCSB PDB
72R PDB via homolog Detail RCSB PDB
72S PDB via homolog Detail RCSB PDB
72T PDB via homolog Detail RCSB PDB
72U PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
2HA RCSB PDB O59413 90.1 Da LogP -1.46 TPSA 57.5 ✓ Ro5 ✓ Clean C(C(=O)CO)O
72R RCSB PDB Q99497 165.1 Da LogP 0.96 TPSA 46.2 ✓ Ro5 ✓ Clean c1cc2c(cc1F)C(=O)C(=O)N2
72S RCSB PDB Q99497 161.2 Da LogP 1.13 TPSA 46.2 ✓ Ro5 ✓ Clean Cc1cccc2c1NC(=O)C2=O
72T RCSB PDB Q99497 215.1 Da LogP 1.84 TPSA 46.2 ✓ Ro5 ✓ Clean c1cc2c(c(c1)C(F)(F)F)NC(=O)C2=O
72U RCSB PDB Q99497 205.2 Da LogP 0.61 TPSA 72.5 ✓ Ro5 ✓ Clean COC(=O)c1cccc2c1NC(=O)C2=O
72V RCSB PDB Q99497 161.2 Da LogP 0.85 TPSA 37.4 ✓ Ro5 ✓ Clean CN1c2ccccc2C(=O)C1=O
73D RCSB PDB Q99497 175.2 Da LogP 1.24 TPSA 37.4 ✓ Ro5 ✓ Clean CCN1c2ccccc2C(=O)C1=O
73G RCSB PDB Q99497 261.3 Da LogP 1.56 TPSA 63.7 ✓ Ro5 ✓ Clean CCCCOC(=O)CN1c2ccccc2C(=O)C1=O
7MT RCSB PDB O59413 556.4 Da LogP -2.25 TPSA 64.8 1 viol. ✓ Clean c1cc2[n+]3c(c1)C(=O)O[Tb]34567[n+]8c(cccc8C(=O)…
DTT RCSB PDB Q99497 154.3 Da LogP -0.43 TPSA 40.5 ✓ Ro5 ✓ Clean C([C@@H]([C@H](CS)O)O)S
ISN RCSB PDB Q99497 147.1 Da LogP 0.82 TPSA 46.2 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(=O)C(=O)N2
MLA RCSB PDB Q99497 104.1 Da LogP -0.45 TPSA 74.6 ✓ Ro5 ✓ Clean C(C(=O)O)C(=O)O
MLI RCSB PDB O59413 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
P15 RCSB PDB Q99497 296.4 Da LogP -0.29 TPSA 75.6 ✓ Ro5 ✓ Clean COCCOCCOCCOCCOCCOCCO
P4C RCSB PDB Q99497 324.4 Da LogP -0.72 TPSA 92.7 ✓ Ro5 ✓ Clean C(COCCOCCOCCOCCOCCOCC=O)O
TLA RCSB PDB Q99497 150.1 Da LogP -2.12 TPSA 115.1 ✓ Ro5 ✓ Clean [C@@H]([C@H](C(=O)O)O)(C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.