KpATCC43816 Protein target profile

D-galactonate transporter family protein

Accession: VK055_3927

Gene: AIK82475.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GXY3
Length 443
Pocket druggability (P2Rank · AlphaFold DB model) 0.948
Direct ligand evidence 0 88 total records
Functional annotation 0 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
27.811 Lower values reduce human off-target concern.
Human E-value
1.63e-19
Gut microbiome similarity
2.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
58.716 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
89.35 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.948
Structure A0A0H3GXY3
Pocket Pocket 1
Druggability (FPocket) 0.91
Structure A0A0H3GXY3
Pocket Pocket 7
ColabFold model
P2Rank 0.962 · Pocket 1
FPocket 0.945 · Pocket 6
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 96 / 4744 genomes with a hit
Prevalence 2.0%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MILDSTLDEKKGIPTRYLILLMIFVVTAVNYGDRATLSIAGTEVAKELGLSAVSMGYIFSAFGWAYLLMQIPGGWLLDKFGSKKVYSYSLFFWSLFTFLQGFIDVFPLAWAGVSMFFMRFMLGFSEAPSFPANARIVAAWFPAKERGTASAIFNAAQYFSLALFSPLLGWLTFALGWEHVFTVMGIIGFVLTIIWVKFVHNPTDHPRMSAAELKYISEGGAVVDMDHKKEATPAAGPKMDYIRQLLTNRMMLGVFFGQYFLNTITWFFLTWFPIYLVQDKGMSILKVGFVASIPALFGFAGGVLGGLFSDYLIGRGCTLTFARKLPIVLGMLLASSIILCNYTASTPLVITLMALAFFGKGFGALGWPVISDVAPKEIVGLCGGVFNVFGNVASIATPLVIGYIVSELHSFNGALIFVGGSALMMMVCYLFVVGDIKRMELQK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

6
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0005975 The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y.
  • GO:0019752 The chemical reactions and pathways involving carboxylic acids, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

53 records
Show feature table
Start End DB Term Name
16 432 CDD cd17319 MFS_ExuT_GudP_like
278 288 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
345 349 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
200 251 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
253 275 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
406 410 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
239 443 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
239 443 InterPro IPR036259 MFS transporter superfamily
383 405 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
53 75 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
9 431 PANTHER PTHR11662 SOLUTE CARRIER FAMILY 17
90 112 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
74 84 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
415 434 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
411 433 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
252 277 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
25 433 NCBIfam TIGR00893 D-galactonate transporter
290 312 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
10 212 FunFam G3DSA:1.20.1250.20:FF:000006 MFS transporter
151 173 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
15 32 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
9 443 PIRSF PIRSF002808 Hexose_phosphate_transp
9 443 InterPro IPR000849 Sugar phosphate transporter
325 344 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
85 103 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
131 150 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
13 209 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
13 209 InterPro IPR036259 MFS transporter superfamily
12 32 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
33 51 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
19 437 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
19 437 InterPro IPR020846 Major facilitator superfamily domain
104 108 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
314 324 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
177 199 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
348 370 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
52 73 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
350 371 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
179 199 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
174 178 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
240 443 FunFam G3DSA:1.20.1250.20:FF:000010 Probable glucarate transporter
434 443 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
5 442 SUPERFAMILY SSF103473 MFS general substrate transporter
5 442 InterPro IPR036259 MFS transporter superfamily
372 377 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
109 130 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
378 405 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
289 313 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 11 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
325 344 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
151 173 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
23 364 Pfam PF07690 Major Facilitator Superfamily
23 364 InterPro IPR011701 Major facilitator superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.948
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.26
Likely same site as FPocket 7 3.6 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.047
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.041
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.036
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #7
0.91
Likely same site as P2Rank 2 3.6 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #29
0.215
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GXY3
AlphaFold DB full sequence Viewing
ColabFold VK055_3927
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

88 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 38 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 37 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
J0M PDB via homolog 196.2 Da · LogP -3.49 · TPSA 138.5 Open detail RCSB PDB
CHEMBL236247 ChEMBL via homolog · pchembl 8.70 (~2.0 nM) Detail ChEMBL
CHEMBL238371 ChEMBL via homolog · pchembl 8.30 (~5.0 nM) Detail ChEMBL
CHEMBL1200712 ChEMBL via homolog · pchembl 7.40 (~39.8 nM) Detail ChEMBL
CHEMBL3218305 ChEMBL via homolog · pchembl 7.10 (~79.4 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
J0M RCSB PDB J7QAK3 196.2 Da LogP -3.49 TPSA 138.5 1 viol. ✓ Clean C([C@H]([C@@H]([C@@H]([C@H](C(=O)O)O)O)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.