KpATCC43816 Protein target profile

DNA topoisomerase IV, B subunit

Accession: VK055_4030

Gene: parE AIK82577.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3H365
Length 631
Pocket druggability (P2Rank · AlphaFold DB model) 0.816
Direct ligand evidence 0 88 total records
Functional annotation 0 EC 5 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
24.696 Lower values reduce human off-target concern.
Human E-value
4.83e-31
Gut microbiome similarity
4.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
94.929 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
87.98 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.816
Structure A0A0H3H365
Pocket Pocket 1
Druggability (FPocket) 0.795
Structure A0A0H3H365
Pocket Pocket 3
ColabFold model
P2Rank 0.886 · Pocket 1
FPocket 0.487 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 194 / 4744 genomes with a hit
Prevalence 4.1%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTQSSYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVEVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYSIAFENGEKVEDLHVTGTCGKRNTGTSVHFWPDESFFDSPRFSVSRLTHLLKAKAVLCPGVEIVFRDQVNNSEQSWCYADGLNDYLSEAVNGLPLLPEKPFVGAFSGETEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFSLWLNQNVQAAELLAEMAISSAQRRLRAAKKVVRKKLTSGPALPGKLADCTAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVAIGIDPDSDDLSQLRYGKICILADADSDGLHIATLLCALFVRHFRTLVKEGHVYVALPPLYRIDLGKEVYYALTEEEKTGVLEQLKRKKGKPNVQRFKGLGEMNPMQLRETTLDPNTRRLVQLVISDEDEQQTTAIMDMLLAKKRSEDRRNWLQEKGDMADLEV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

5
  • GO:0003918 Catalysis of a DNA topological transformation by transiently cleaving a pair of complementary DNA strands to form a gate through which a second double-stranded DNA segment is passed, after which the severed strands in the first DNA segment are rejoined, driven by ATP hydrolysis. The enzyme changes the linking number in multiples of 2.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0006265 The process in which a transformation is induced in the topological structure of a double-stranded DNA helix, resulting in a change in linking number.
  • GO:0005694 A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

75 records
Show feature table
Start End DB Term Name
389 622 SUPERFAMILY SSF56719 Type II DNA topoisomerase
389 622 InterPro IPR013760 DNA topoisomerase, type IIA-like domain superfamily
498 515 PRINTS PR00418 DNA topoisomerase II family signature
110 124 PRINTS PR00418 DNA topoisomerase II family signature
67 80 PRINTS PR00418 DNA topoisomerase II family signature
267 280 PRINTS PR00418 DNA topoisomerase II family signature
480 496 PRINTS PR00418 DNA topoisomerase II family signature
32 47 PRINTS PR00418 DNA topoisomerase II family signature
518 530 PRINTS PR00418 DNA topoisomerase II family signature
561 577 PRINTS PR00418 DNA topoisomerase II family signature
415 429 PRINTS PR00418 DNA topoisomerase II family signature
175 192 PRINTS PR01098 Topoisomerase IV subunit B signature
175 192 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
193 214 PRINTS PR01098 Topoisomerase IV subunit B signature
193 214 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
312 327 PRINTS PR01098 Topoisomerase IV subunit B signature
312 327 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
150 165 PRINTS PR01098 Topoisomerase IV subunit B signature
150 165 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
504 520 PRINTS PR01098 Topoisomerase IV subunit B signature
504 520 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
470 482 PRINTS PR01098 Topoisomerase IV subunit B signature
470 482 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
136 150 PRINTS PR01098 Topoisomerase IV subunit B signature
136 150 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
239 262 PRINTS PR01098 Topoisomerase IV subunit B signature
239 262 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
449 470 PRINTS PR01098 Topoisomerase IV subunit B signature
449 470 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
27 40 PRINTS PR01098 Topoisomerase IV subunit B signature
27 40 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
295 311 PRINTS PR01098 Topoisomerase IV subunit B signature
295 311 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
538 560 PRINTS PR01098 Topoisomerase IV subunit B signature
538 560 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
339 362 PRINTS PR01098 Topoisomerase IV subunit B signature
339 362 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
363 388 PRINTS PR01098 Topoisomerase IV subunit B signature
363 388 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
29 172 Pfam PF02518 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
29 172 InterPro IPR003594 Histidine kinase/HSP90-like ATPase
3 629 Hamap MF_00938 DNA topoisomerase 4 subunit B [parE].
3 629 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
2 629 PANTHER PTHR45866 DNA GYRASE/TOPOISOMERASE SUBUNIT B
557 621 Pfam PF00986 DNA gyrase B subunit, carboxyl terminus
557 621 InterPro IPR002288 DNA gyrase B subunit, C-terminal
6 216 SUPERFAMILY SSF55874 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
6 216 InterPro IPR036890 Histidine kinase/HSP90-like ATPase superfamily
217 390 Gene3D G3DSA:3.30.230.10 -
217 390 InterPro IPR014721 Ribosomal protein S5 domain 2-type fold, subgroup
28 174 SMART SM00387 HKATPase_4
28 174 InterPro IPR003594 Histidine kinase/HSP90-like ATPase
391 624 FunFam G3DSA:3.40.50.670:FF:000003 DNA topoisomerase 4 subunit B
413 526 ProSiteProfiles PS50880 Toprim domain profile.
413 526 InterPro IPR006171 TOPRIM domain
217 390 FunFam G3DSA:3.30.230.10:FF:000012 DNA topoisomerase 4 subunit B
414 522 Pfam PF01751 Toprim domain
414 522 InterPro IPR006171 TOPRIM domain
33 214 CDD cd16928 HATPase_GyrB-like
218 383 SUPERFAMILY SSF54211 Ribosomal protein S5 domain 2-like
218 383 InterPro IPR020568 Ribosomal protein S5 domain 2-type fold
5 626 NCBIfam TIGR01055 DNA topoisomerase IV subunit B
5 626 InterPro IPR005737 DNA topoisomerase IV, subunit B, Gram-negative
417 425 ProSitePatterns PS00177 DNA topoisomerase II signature.
417 425 InterPro IPR018522 DNA topoisomerase, type IIA, conserved site
3 216 Gene3D G3DSA:3.30.565.10 -
3 216 InterPro IPR036890 Histidine kinase/HSP90-like ATPase superfamily
391 624 Gene3D G3DSA:3.40.50.670 -
391 624 InterPro IPR013759 DNA topoisomerase, type IIA, subunit B, C-terminal
3 217 FunFam G3DSA:3.30.565.10:FF:000002 DNA gyrase subunit B
35 625 SMART SM00433 topII5
35 625 InterPro IPR001241 DNA topoisomerase, type IIA
218 387 CDD cd00822 TopoII_Trans_DNA_gyrase
219 385 Pfam PF00204 DNA gyrase B
219 385 InterPro IPR013506 DNA topoisomerase, type IIA, subunit B, domain 2

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.816
Likely same site as FPocket 3 1.2 Å 26 shared residues 96% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.247
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.071
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.058
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.018
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.795
Likely same site as P2Rank 1 1.2 Å 26 shared residues 96% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #44
0.317
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:111-117
UniProt: Binding site:335-335
UniProt: Binding site:43-43
UniProt: Binding site:6-6
UniProt: Binding site:70-70
UniProt: Site:447-447 Interaction with DNA
UniProt: Site:498-498 Interaction with DNA
UniProt: Site:616-616 Interaction with DNA
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3H365
AlphaFold DB full sequence Viewing
ColabFold VK055_4030
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

88 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 38 records from similar proteins
Structural ligands 20 0 loaded crystals
Measured bioactivity 18 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
19X PDB via homolog 426.9 Da · LogP 3.44 · TPSA 100.3 Open detail RCSB PDB
19Y PDB via homolog Detail RCSB PDB
1AV PDB via homolog Detail RCSB PDB
1EU PDB via homolog Detail RCSB PDB
1UV PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
19X RCSB PDB A0A0J9WZF0 426.9 Da LogP 3.44 TPSA 100.3 ✓ Ro5 ✓ Clean CCc1c(c2c([nH]1)nc(nc2N3CC[C@H](C3)N)Sc4ccc5c(c…
19Y RCSB PDB A0A0J9WZF0 314.4 Da LogP 2.89 TPSA 80.8 ✓ Ro5 ✓ Clean CCc1c(c2c([nH]1)nc(nc2OC)Sc3cccnc3)C=O
1AV RCSB PDB P20083 295.3 Da LogP 1.92 TPSA 95.4 ✓ Ro5 ✓ Clean c1cc(cnc1)c2nc3c(nc(nc3s2)N)n4ccnc4
1EU RCSB PDB P20083 323.4 Da LogP 2.97 TPSA 99.8 ✓ Ro5 ✓ Clean CCNC(=O)Nc1[nH]c2cc(cc(c2n1)C(=O)C)c3cccnc3
1UV RCSB PDB Q59961 373.4 Da LogP 1.61 TPSA 97.8 ✓ Ro5 ✓ Clean c1c2c(c3c(c1F)N4CC[C@H]([C@H]4COC3)N)N(C=C(C2=O…
1YP RCSB PDB Q8DQB5 477.4 Da LogP 3.77 TPSA 138.7 ✓ Ro5 ✓ Clean CCNC(=O)Nc1cc(c(cn1)c2cc(cnc2)C3=NNC(=O)O3)c4nc…
2B7 RCSB PDB Q8DQB5 397.5 Da LogP 3.87 TPSA 88.9 ✓ Ro5 ✓ Clean CC(C)CCN1c2c(nc(s2)NC(=O)NCC=C)C=C(C1=O)c3cccnc3
AF5 RCSB PDB Q59961 369.4 Da LogP 2.50 TPSA 88.6 ✓ Ro5 ✓ Clean c1c2c(c3c(c1F)N4CC[C@H]([C@H]4CC=C3)N)N(C=C(C2=…
ANP RCSB PDB P20083 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
BHW RCSB PDB Q5SHZ4 1110.1 Da LogP 5.57 TPSA 354.9 4 viol. ✓ Clean Cc1ccc([nH]1)C(=O)O[C@H]2[C@H]([C@@H](OC([C@@H]…
CJC RCSB PDB A0A0J9WZF0 442.9 Da LogP 2.49 TPSA 129.5 ✓ Ro5 ✓ Clean CCc1c(c2c([nH]1)nc(nc2N3CC[C@H](C3)N)Sc4cc5c(nc…
DOO RCSB PDB A0A0J9WZF0 434.5 Da LogP 2.98 TPSA 103.9 ✓ Ro5 ✓ Clean Cc1ncc(cn1)Oc2nc3c(c4cc(cc(c4[nH]3)NC)F)c(n2)N5…
LFX RCSB PDB Q59961 361.4 Da LogP 1.54 TPSA 75.0 ✓ Ro5 ✓ Clean C[C@H]1COc2c3c(cc(c2N4CCN(CC4)C)F)C(=O)C(=CN31)…
MFX RCSB PDB Q59961 401.4 Da LogP 2.37 TPSA 83.8 ✓ Ro5 ✓ Clean COc1c2c(cc(c1N3C[C@@H]4CCCN[C@@H]4C3)F)C(=O)C(=…
NFX RCSB PDB Q59961 365.8 Da LogP 2.36 TPSA 88.6 ✓ Ro5 ✓ Clean c1c2c(c(c(c1F)N3CC[C@H](C3)N)Cl)N(C=C(C2=O)C(=O…
NOV RCSB PDB P20083 612.6 Da LogP 3.63 TPSA 200.0 2 viol. ✓ Clean Cc1c(ccc2c1OC(=O)C(=C2O)NC(=O)c3ccc(c(c3)CC=C(C…
PDQ RCSB PDB Q59961 361.4 Da LogP 0.83 TPSA 99.3 ✓ Ro5 ✓ Clean Cc1c2c(cc(c1N3CC[C@H](C3)[C@H](C)N)F)C(=O)N(C(=…
TR6 RCSB PDB Q59961 416.4 Da LogP 1.89 TPSA 101.5 ✓ Ro5 ✓ Clean c1cc(c(cc1F)F)N2C=C(C(=O)c3c2nc(c(c3)F)N4C[C@@H…
TSJ RCSB PDB Q8DQB5 403.4 Da LogP 4.66 TPSA 95.1 ✓ Ro5 ✓ Clean Cc1cc(cc(c1)C(F)(F)F)c2cc([nH]n2)NC(=O)c3ccc(cc…
TTJ RCSB PDB Q8DQB5 301.3 Da LogP 2.05 TPSA 76.2 ✓ Ro5 ✓ Clean Cc1cc(cc(c1)c2cc([nH]n2)NC(=O)[C@H]3COCCO3)C

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.