KpATCC43816 Protein target profile

mechanosensitive channel MscS

Accession: VK055_4129

Gene: yggB AIK82675.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GXD9
Length 285
Pocket druggability (FPocket · AlphaFold DB model) 0.834
Direct ligand evidence 0 59 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
32.5 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
92.34 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank)
Structure A0A0H3GXD9
Pocket No pockets
Druggability (FPocket) 0.834
Structure A0A0H3GXD9
Pocket Pocket 3
ColabFold model
FPocket 0.767 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 116 / 4744 genomes with a hit
Prevalence 2.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MEDLNVVDSINHAGTWLARNQELLLSYAVNIVAAIAILIVGMIVARVVSNTVNRLMLARKIDATVADFLSALVRYAVIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGVAGTVLNVQIFSTTLRTADGKVVVVPNGKIIAGNIINFSREPARRNEFIIGVAYDADIDKVKQLLTSIIESDDRILRDREMTVRLNELGASSVNFVVRVWSKSSDLQNVYWDILERIKREFDANGISFPYPQMDVHVVRLPEKAE

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

4
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0008381 Enables the transmembrane transfer of an monoatomic ion by a channel that opens in response to a mechanical stress.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

29 records
Show feature table
Start End DB Term Name
49 67 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
126 285 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
129 178 Gene3D G3DSA:2.30.30.60 -
129 178 InterPro IPR023408 Mechanosensitive ion channel MscS, beta-domain superfamily
92 96 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
27 128 Gene3D G3DSA:1.10.287.1260 -
72 268 Pfam PF00924 Mechanosensitive ion channel
72 268 InterPro IPR006685 Mechanosensitive ion channel MscS
1 23 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
15 64 Pfam PF05552 Conserved TM helix
15 64 InterPro IPR008910 Conserved TM helix
65 87 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
94 116 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
8 277 PANTHER PTHR30221 SMALL-CONDUCTANCE MECHANOSENSITIVE CHANNEL
8 277 InterPro IPR045275 Mechanosensitive ion channel MscS, archaea/bacteria type
143 177 ProSitePatterns PS01246 Uncharacterized protein family UPF0003 signature.
143 177 InterPro IPR006686 Mechanosensitive ion channel MscS, conserved site
24 48 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
28 112 SUPERFAMILY SSF82861 Mechanosensitive channel protein MscS (YggB), transmembrane region
28 112 InterPro IPR011014 Mechanosensitive ion channel MscS, transmembrane-2
68 91 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
129 177 FunFam G3DSA:2.30.30.60:FF:000001 MscS Mechanosensitive ion channel
181 277 SUPERFAMILY SSF82689 Mechanosensitive channel protein MscS (YggB), C-terminal domain
181 277 InterPro IPR011066 Mechanosensitive ion channel MscS, C-terminal
23 45 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
97 125 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
114 179 SUPERFAMILY SSF50182 Sm-like ribonucleoproteins
114 179 InterPro IPR010920 LSM domain superfamily
179 273 Gene3D G3DSA:3.30.70.100 -

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #3
0.834
Show in viewer
Surrounding area
Pocket 2 FPocket #5
0.711
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GXD9
AlphaFold DB full sequence Viewing
ColabFold VK055_4129
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 9 records from similar proteins
Structural ligands 9 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
D12 PDB via homolog 170.3 Da · LogP 4.93 · TPSA 0.0 Open detail RCSB PDB
HEX PDB via homolog Detail RCSB PDB
LFA PDB via homolog Detail RCSB PDB
LMT PDB via homolog Detail RCSB PDB
PCW PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
D12 RCSB PDB Q8VZL4 170.3 Da LogP 4.93 TPSA 0.0 ✓ Ro5 ✓ Clean CCCCCCCCCCCC
HEX RCSB PDB P0C0S1 86.2 Da LogP 2.59 TPSA 0.0 ✓ Ro5 ✓ Clean CCCCCC
LFA RCSB PDB Q8VZL4 282.6 Da LogP 8.05 TPSA 0.0 1 viol. ✓ Clean CCCCCCCCCCCCCCCCCCCC
LMT RCSB PDB P0C0S1 510.6 Da LogP -0.45 TPSA 178.5 3 viol. ✓ Clean CCCCCCCCCCCCO[C@H]1[C@@H]([C@H]([C@@H]([C@H](O1…
PCW RCSB PDB P0C0S1 787.1 Da LogP 12.36 TPSA 108.4 2 viol. ✓ Clean CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)…
PEE RCSB PDB P0AEB5 744.0 Da LogP 11.61 TPSA 134.4 2 viol. ✓ Clean CCCCCCCC/C=C\CCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCN…
POV RCSB PDB P0C0S1 760.1 Da LogP 11.17 TPSA 111.2 2 viol. ✓ Clean CCCCCCCCCCCCCCCC(=O)OC[C@@H](CO[P@](=O)([O-])OC…
QGD RCSB PDB P0AEB5 750.1 Da LogP 11.20 TPSA 154.6 2 viol. ✓ Clean CCCCCCCCCCCCCCCCCCCCOC[C@H](COP(=O)(O)OC[C@@H](…
R16 RCSB PDB P0C0S1 226.4 Da LogP 6.49 TPSA 0.0 1 viol. ✓ Clean CCCCCCCCCCCCCCCC

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.