KpATCC43816 Protein target profile

argP transcriptional activator

Accession: VK055_4132

Gene: iciA AIK82678.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GV81
Length 297
Pocket druggability (P2Rank · AlphaFold DB model) 0.64
Direct ligand evidence 0 52 total records
Functional annotation 0 EC 3 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
48.438 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
90.73 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.64
Structure A0A0H3GV81
Pocket Pocket 1
Druggability (FPocket) 0.435
Structure A0A0H3GV81
Pocket Pocket 8
ColabFold model
P2Rank 0.402 · Pocket 1
FPocket 0.268 · Pocket 18
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 117 / 4744 genomes with a hit
Prevalence 2.5%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPTEQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLATWLLPALANVLSDSPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQALPSCLVDQLGALDYLFVASKEFAQRYFPNGVTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELNSGELIDLTPGLFQRRMLYWHRFAPESRMMRRVTDALIDYGHKVLRQD

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

26 records
Show feature table
Start End DB Term Name
1 296 Hamap MF_00513 HTH-type transcriptional regulator ArgP [argP].
1 296 InterPro IPR023490 HTH-type transcriptional regulator ArgP, gammaproteobacteria
2 77 Gene3D G3DSA:1.10.10.10 -
2 77 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
5 293 NCBIfam TIGR03298 ArgP/LysG family DNA-binding transcriptional regulator
5 293 InterPro IPR017685 HTH-type transcriptional regulator ArgP
78 297 FunFam G3DSA:3.40.190.290:FF:000002 HTH-type transcriptional regulator ArgP
92 289 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
78 297 Gene3D G3DSA:3.40.190.290 -
4 111 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
4 111 InterPro IPR036390 Winged helix DNA-binding domain superfamily
1 296 PANTHER PTHR30579 TRANSCRIPTIONAL REGULATOR
93 286 CDD cd08428 PBP2_IciA_ArgP
2 78 FunFam G3DSA:1.10.10.10:FF:000061 HTH-type transcriptional regulator ArgP
93 287 Pfam PF03466 LysR substrate binding domain
93 287 InterPro IPR005119 LysR, substrate-binding
4 60 ProSiteProfiles PS50931 LysR-type HTH domain profile.
4 60 InterPro IPR000847 Transcription regulator HTH, LysR
21 32 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
21 32 InterPro IPR000847 Transcription regulator HTH, LysR
32 42 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
32 42 InterPro IPR000847 Transcription regulator HTH, LysR
42 53 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
42 53 InterPro IPR000847 Transcription regulator HTH, LysR
7 64 Pfam PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
7 64 InterPro IPR000847 Transcription regulator HTH, LysR

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.64
Likely same site as FPocket 1 1.3 Å 15 shared residues 94% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.049
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.042
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.016
Likely same site as FPocket 8 6.8 Å 7 shared residues 78% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #8
0.435
Likely same site as P2Rank 4 6.8 Å 7 shared residues 78% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #1
0.378
Likely same site as P2Rank 1 1.3 Å 15 shared residues 94% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GV81
AlphaFold DB full sequence Viewing
ColabFold VK055_4132
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
FLC PDB via homolog 189.1 Da · LogP -5.25 · TPSA 140.6 Open detail RCSB PDB
P33 PDB via homolog Detail RCSB PDB
ZINC12501520 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC3874716 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC4283769 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
FLC RCSB PDB A0A0D1IHL7 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
P33 RCSB PDB A9CJQ0 326.4 Da LogP -0.93 TPSA 95.8 ✓ Ro5 ✓ Clean C(COCCOCCOCCOCCOCCOCCO)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.