Protein target profile

VK055_4136

5-formyltetrahydrofolate cyclo-ligase

Genome: KpATCC43816 Gene: AIK82682.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism 1 reaction UniProt A0A0H3H2P0
Length 198
Pocket druggability 0.99
Metabolic reactions 1
Chokepoint No
Direct ligand evidence 0 4 total records
Functional annotation 0 EC 0 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
27.2 Lower values reduce human off-target concern.
Human E-value
7.39e-07
Gut microbiome similarity
3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
54.237 Higher values support similarity to known essential genes.
DEG E-value
2.77e-63 Smaller values mean stronger essential-gene similarity.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
93.73 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.99
Structure A0A0H3H2P0
Pocket Pocket 1
P2Rank 0.875
Structure A0A0H3H2P0
Pocket Pocket 1
ColabFold model
FPocket 0.931 · Pocket 1
P2Rank 0.881 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 144 / 4744 genomes with a hit
Prevalence 3.0%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

Explore metabolic network
Relative network centrality 0.0% more central than 0.0% of genes in this genome
Chokepoint Not a chokepoint
Catalyzed reaction

1 reaction mapped to this gene in the metabolic model. Open the full network to see each one, with substrates/products and the reaction-reaction map.

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MTIQPDTLLSRQHIRQQIRDRRRALSPEQQRLFAQQAAERMMAWPPIVLAHNVALFLSFDGELDTQPLIDQLWRAGKRVYLPVLHPFSPGNLLFLHYHPQSQLIVNRLKIREPKLDVRDVLPLAELDVLVTPLVAFDVSGQRLGMGGGFYDRTLQNWQQYRLQPVGYAHDCQQVDSLPSEEWDIPLPAVITPGKTWCW

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
6 196 Gene3D G3DSA:3.40.50.10420 -
6 196 InterPro IPR024185 5-formyltetrahydrofolate cyclo-ligase-like domain superfamily
11 195 PANTHER PTHR23407 ATPASE INHIBITOR/5-FORMYLTETRAHYDROFOLATE CYCLO-LIGASE
11 195 InterPro IPR002698 5-formyltetrahydrofolate cyclo-ligase
12 192 Pfam PF01812 5-formyltetrahydrofolate cyclo-ligase family
12 192 InterPro IPR002698 5-formyltetrahydrofolate cyclo-ligase
7 195 PIRSF PIRSF006806 5_FTHF
7 195 InterPro IPR002698 5-formyltetrahydrofolate cyclo-ligase
11 192 NCBIfam TIGR02727 5-formyltetrahydrofolate cyclo-ligase
11 192 InterPro IPR002698 5-formyltetrahydrofolate cyclo-ligase
10 198 SUPERFAMILY SSF100950 NagB/RpiA/CoA transferase-like
10 198 InterPro IPR037171 NagB/RpiA transferase-like
17 197 FunFam G3DSA:3.40.50.10420:FF:000005 5-formyltetrahydrofolate cyclo-ligase

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.99
Likely same site as P2Rank 1 0.4 Å 28 shared residues 97% of smaller site
Unusual size
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.875
Likely same site as FPocket 1 0.4 Å 28 shared residues 97% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Binding site:11-15
UniProt: Binding site:142-150
UniProt: Binding site:57-57
UniProt: Binding site:62-62
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3H2P0
AlphaFold DB full sequence Viewing
ColabFold VK055_4136
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

4 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 2 similarity-based ZINC candidates
Best available ligand signal
10F PDB via homolog 479.5 Da · LogP -3.29 · TPSA 218.4 Open detail RCSB PDB
N5G PDB via homolog Detail RCSB PDB
ZINC8536462 ZINC proposed compound · Tanimoto 0.549 Detail ZINC
ZINC4228247 ZINC proposed compound · Tanimoto 0.542 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
10F RCSB PDB P49914 479.5 Da LogP -3.29 TPSA 218.4 1 viol. ✓ Clean c1cc(ccc1C(=O)N[C@H](CCC(=O)O)C(=O)O)N(C[C@@H]2…
N5G RCSB PDB P49914 567.5 Da LogP -3.64 TPSA 268.1 3 viol. ✓ Clean C1CC(CCC1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC[C@H]2C…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.