KpATCC43816 Protein target profile

putative adhesin

Accession: VK055_4483

Gene: AIK83026.1 3D evidence: Experimental + ColabFold model Metabolism Not in network UniProt A0A4S7G0W1
Length 286
Pocket druggability (P2Rank · Experimental) 0.12
Direct ligand evidence 0 1 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.3% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
43.31 Higher values support similarity to known essential genes.
DEG E-value
9.23e-70 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
94.08 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

PDB experimental structure

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.12
Structure 8SVC
Pocket Pocket 1
Druggability (FPocket) 0.193
Structure 8SVC
Pocket Pocket 14
ColabFold model
P2Rank 0.197 · Pocket 1
FPocket 0.343 · Pocket 6
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 64 / 4744 genomes with a hit
Prevalence 1.3%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MVALALGLMAQGAMAKTLNVVSSFSVLGDIAQQVGGEHVHVDTLVGPDGDPHTFEPSPKDSALLSKADVVVVNGLGLEGWLDRLIKASGFKGELVVASKGVKTHTLDEEGKTVTDPHAWNSAANGALYAQNILEGLVKADPEDKAALTSSGKRYIDQLTSLDGWAKAQFSAIPLAKRKVLTSHDAFGYFGRAYHVTFLAPQGLSSESEASAAQVAALIKQIKADGVHTWFMENQLDPRLVKQIASATGAQPGGELYPEALSKPGGVADSYVKMMRHNVELIANSMK

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

4
  • GO:0030001 The directed movement of metal ions, any metal ion with an electric charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0007155 The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
  • GO:0046872 Binding to a metal ion.
  • GO:0030313 An envelope that surrounds a bacterial cell and includes the cytoplasmic membrane and everything external, encompassing the periplasmic space, cell wall, and outer membrane if present.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

38 records
Show feature table
Start End DB Term Name
3 286 PANTHER PTHR42953 HIGH-AFFINITY ZINC UPTAKE SYSTEM PROTEIN ZNUA-RELATED
225 243 PRINTS PR00690 Adhesin family signature
225 243 InterPro IPR006128 Adhesion lipoprotein
251 270 PRINTS PR00690 Adhesin family signature
251 270 InterPro IPR006128 Adhesion lipoprotein
48 61 PRINTS PR00690 Adhesin family signature
48 61 InterPro IPR006128 Adhesion lipoprotein
172 193 PRINTS PR00690 Adhesin family signature
172 193 InterPro IPR006128 Adhesion lipoprotein
61 78 PRINTS PR00690 Adhesin family signature
61 78 InterPro IPR006128 Adhesion lipoprotein
17 35 PRINTS PR00690 Adhesin family signature
17 35 InterPro IPR006128 Adhesion lipoprotein
1 286 CDD cd01137 PsaA
17 160 Gene3D G3DSA:3.40.50.1980 Nitrogenase molybdenum iron protein domain
16 286 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
14 286 SUPERFAMILY SSF53807 Helical backbone metal receptor
1 15 Phobius SIGNAL_PEPTIDE Signal peptide region
11 15 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 15 SignalP_EUK SignalP-noTM SignalP-noTM
161 286 Gene3D G3DSA:3.40.50.1980 Nitrogenase molybdenum iron protein domain
1 15 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
1 1 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
264 282 PRINTS PR00691 Adhesin B signature
264 282 InterPro IPR006129 Adhesin B
221 238 PRINTS PR00691 Adhesin B signature
221 238 InterPro IPR006129 Adhesin B
17 38 PRINTS PR00691 Adhesin B signature
17 38 InterPro IPR006129 Adhesin B
172 189 PRINTS PR00691 Adhesin B signature
172 189 InterPro IPR006129 Adhesin B
42 60 PRINTS PR00691 Adhesin B signature
42 60 InterPro IPR006129 Adhesin B
61 80 PRINTS PR00691 Adhesin B signature
61 80 InterPro IPR006129 Adhesin B
20 283 Pfam PF01297 Zinc-uptake complex component A periplasmic
20 283 InterPro IPR006127 Periplasmic solute binding protein, ZnuA-like
2 10 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.12
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.032
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.024
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.015
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.011
Show in viewer
Surrounding area
All structural evidence 1 experimental · 1 predicted

Structural evidence

1 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 8SVC
X-ray 1.59 Å A
92.7% 22-286
Viewing
ColabFold VK055_4483
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

1 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 1 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 0 similarity-based ZINC candidates
Best available ligand signal
CAC PDB via homolog 137.0 Da · LogP -0.52 · TPSA 40.1 Open detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
CAC RCSB PDB Q79EF9 137.0 Da LogP -0.52 TPSA 40.1 ✓ Ro5 ✓ Clean C[As](=O)(C)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Structure