Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.9% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 91.42 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MDGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHCIQALAGASGSPEPALRRFELALLGHLGYGVDFLHCAGSGEPVDDTMTYRYREEKGFIASLVIDNNTFTGHHLKALASREFPDVDTLRAAKRFTRIALKPYLGGKPLKSRELFRQFMPARKARADNTNND
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
4- GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
- GO:0006310 Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Interchromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
- GO:0043590 The region of a bacterial cell to which the DNA is confined.
- GO:0006302 The repair of double-strand breaks in DNA via homologous and nonhomologous mechanisms to reform a continuous DNA helix.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 83 | 226 | Pfam | PF02565 | Recombination protein O C terminal |
| 83 | 226 | InterPro | IPR003717 | Recombination protein O, RecO |
| 4 | 75 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins |
| 4 | 75 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
| 79 | 241 | Gene3D | G3DSA:1.20.1440.120 | - |
| 79 | 241 | InterPro | IPR042242 | Recombination protein O, C-terminal |
| 1 | 78 | FunFam | G3DSA:2.40.50.140:FF:000074 | DNA repair protein RecO |
| 1 | 231 | Hamap | MF_00201 | DNA repair protein RecO [recO]. |
| 1 | 231 | InterPro | IPR003717 | Recombination protein O, RecO |
| 1 | 78 | Gene3D | G3DSA:2.40.50.140 | - |
| 1 | 78 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
| 86 | 168 | SUPERFAMILY | SSF57863 | ArfGap/RecO-like zinc finger |
| 86 | 168 | InterPro | IPR037278 | ARFGAP/RecO-like zinc finger |
| 1 | 234 | PANTHER | PTHR33991 | DNA REPAIR PROTEIN RECO |
| 1 | 234 | InterPro | IPR003717 | Recombination protein O, RecO |
| 5 | 76 | Pfam | PF11967 | Recombination protein O N terminal |
| 5 | 76 | InterPro | IPR022572 | DNA replication/recombination mediator RecO, N-terminal |
| 5 | 230 | NCBIfam | TIGR00613 | DNA repair protein RecO |
| 5 | 230 | InterPro | IPR003717 | Recombination protein O, RecO |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3H1L1
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_4611
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC72399572 ZINC | 0.733 | 492.7 Da LogP 3.43 TPSA 93.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCCCN(C)C)[C@H]1CC[C@H]2[C@H]3[C@…
|
| ZINC1889002139 ZINC | 0.703 | 449.7 Da LogP 3.89 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
CCCNC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@H]3[C@H](…
|
| ZINC1889002140 ZINC | 0.703 | 449.7 Da LogP 3.89 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
CCCNC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@H]3[C@H](…
|
| ZINC1889002141 ZINC | 0.703 | 449.7 Da LogP 3.89 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
CCCNC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@@H]3[C@H]…
|
| ZINC1889002142 ZINC | 0.703 | 449.7 Da LogP 3.89 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
CCCNC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@@H]3[C@H]…
|
| ZINC71773889 ZINC | 0.667 | 206.1 Da LogP -1.77 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(C[C@H](O)C(=O)O)C[C@H](O)C(=O)O
|
| ZINC71773890 ZINC | 0.667 | 206.1 Da LogP -1.77 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(C[C@H](O)C(=O)O)C[C@@H](O)C(=O)O
|
| ZINC71773891 ZINC | 0.667 | 206.1 Da LogP -1.77 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(C[C@@H](O)C(=O)O)C[C@@H](O)C(=O)O
|
| ZINC118912648 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@…
|
| ZINC118912649 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC118912650 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@…
|
| ZINC118912651 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC118913700 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C…
|
| ZINC118913701 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC17654510 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC1857777516 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C…
|
| ZINC2060999620 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC2060999621 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC2060999622 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC253497644 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C…
|
| ZINC253497645 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[C…
|
| ZINC253497646 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[…
|
| ZINC253497647 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@H]3[…
|
| ZINC253608430 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C…
|
| ZINC253615012 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC253615013 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC253615014 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC253615015 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3[…
|
| ZINC38144567 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@…
|
| ZINC40164193 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC53683926 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C@…
|
| ZINC61389426 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@…
|
| ZINC61389432 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C…
|
| ZINC80852657 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@…
|
| ZINC8143774 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H…
|
| ZINC85426221 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C…
|
| ZINC85426225 ZINC | 0.658 | 465.6 Da LogP 2.56 TPSA 127.1 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)NCC(=O)O)[C@H]1CC[C@@H]2[C@H]3[C@…
|
| ZINC1888994477 ZINC | 0.649 | 447.7 Da LogP 3.67 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
C=CCNC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@H]3[C@H]…
|
| ZINC1888994478 ZINC | 0.649 | 447.7 Da LogP 3.67 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
C=CCNC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@H]3[C@H]…
|
| ZINC1888994479 ZINC | 0.649 | 447.7 Da LogP 3.67 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
C=CCNC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@@H]3[C@H…
|
| ZINC1888994480 ZINC | 0.649 | 447.7 Da LogP 3.67 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
C=CCNC(=O)CC[C@@H](C)[C@H]1CC[C@@H]2[C@@H]3[C@H…
|
| ZINC17654071 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@@H]3[C@H](O)C[…
|
| ZINC2060993461 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3[C@H](O)…
|
| ZINC2060993462 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3[C@H](O)…
|
| ZINC40164245 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@H]3[C@H](C[C@H…
|
| ZINC599380959 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@@H]3[C@H](O)C…
|
| ZINC6920392 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@H]2[C@H]3[C@H](C[C@…
|
| ZINC70691804 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C@H](O)C…
|
| ZINC8214948 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C@H](C[C…
|
| ZINC85603116 ZINC | 0.622 | 408.6 Da LogP 3.45 TPSA 98.0 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@H]3[C@H](C[C…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.