KpATCC43816 Protein target profile

aldose 1-epimerase family protein

Accession: VK055_4630

Gene: AIK83164.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GRS1
Length 277
Pocket druggability (P2Rank · AlphaFold DB model) 0.82
Direct ligand evidence 0 17 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
25.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
97.42 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.82
Structure A0A0H3GRS1
Pocket Pocket 1
Druggability (FPocket) 0.767
Structure A0A0H3GRS1
Pocket Pocket 1
ColabFold model
P2Rank 0.816 · Pocket 1
FPocket 0.426 · Pocket 3
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 17 / 4744 genomes with a hit
Prevalence 0.4%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MAEEWILENAHLRMCVSSLGGKVQSLFSRQYQAPVLYENPAGGMFPMLPLANRVAGNRFIFHGQEIVLPRHHADEYFFLHGDGWLQRWDIIECGAEYCVLQLRRQHACGFDYLAQLRYQLLRNQLIAELTLTHYGEVPALYGCGFHPFFPFDERSKVQFQVSGYWPEGENHLPLNWQGNLPDYANFSVAQFGEDRWLNVGYSGWGGRARVSNDVMNITILSQTPWLMLFRMQGESFLCLEPQSHPVNAHNMDGQPGLRVLGAGEKLNFSLKIIIEGA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

4
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
  • GO:0030246 Binding to a carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
  • GO:0005975 The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y.
  • GO:0016853 Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

7 records
Show feature table
Start End DB Term Name
3 272 SUPERFAMILY SSF74650 Galactose mutarotase-like
3 272 InterPro IPR011013 Galactose mutarotase-like domain superfamily
12 272 CDD cd09021 Aldose_epim_Ec_YphB
7 271 Pfam PF01263 Aldose 1-epimerase
7 271 InterPro IPR008183 Aldose 1-/Glucose-6-phosphate 1-epimerase
5 275 Gene3D G3DSA:2.70.98.10 -
5 275 InterPro IPR014718 Glycoside hydrolase-type carbohydrate-binding

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.82
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.068
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.045
Likely same site as FPocket 3 3.4 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.767
Show in viewer
Surrounding area
Pocket 2 FPocket #3
0.344
Likely same site as P2Rank 3 3.4 Å 11 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GRS1
AlphaFold DB full sequence Viewing
ColabFold VK055_4630
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

17 records
Chemistry signal

Only proposed virtual-screening candidates are available for this target.

Direct evidence 0 same-protein records
Transferred evidence 0 records from similar proteins
Structural ligands 0 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 17 similarity-based ZINC candidates
Best available ligand signal
ZINC1532902 ZINC proposed compound Tanimoto 0.700 206.2 Da · LogP -0.86 · TPSA 132.1 Open detail ZINC
ZINC2018106 ZINC proposed compound · Tanimoto 0.700 Detail ZINC
ZINC3593496 ZINC proposed compound · Tanimoto 0.652 Detail ZINC
ZINC3593497 ZINC proposed compound · Tanimoto 0.652 Detail ZINC
ZINC14686440 ZINC proposed compound · Tanimoto 0.625 Detail ZINC

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Show only:
Ligand Tanimoto MW · LogP · TPSA Lipinski PAINS SMILES
ZINC1532902 ZINC 0.700 206.2 Da LogP -0.86 TPSA 132.1 ✓ Ro5 ✓ Clean O=C(O)CC[C@@](O)(CC(=O)O)C(=O)O
ZINC2018106 ZINC 0.700 206.2 Da LogP -0.86 TPSA 132.1 ✓ Ro5 ✓ Clean O=C(O)CC[C@](O)(CC(=O)O)C(=O)O
ZINC3593496 ZINC 0.652 206.2 Da LogP -1.16 TPSA 121.1 ✓ Ro5 ✓ Clean COC(=O)C[C@@](O)(CC(=O)O)C(=O)O
ZINC3593497 ZINC 0.652 206.2 Da LogP -1.16 TPSA 121.1 ✓ Ro5 ✓ Clean COC(=O)C[C@](O)(CC(=O)O)C(=O)O
ZINC14686440 ZINC 0.625 436.4 Da LogP -2.64 TPSA 247.9 1 viol. ✓ Clean O=C(O)C[C@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=O…
ZINC14686442 ZINC 0.625 436.4 Da LogP -2.64 TPSA 247.9 1 viol. ✓ Clean O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@](O)(CC(=O…
ZINC14686444 ZINC 0.625 436.4 Da LogP -2.64 TPSA 247.9 1 viol. ✓ Clean O=C(O)C[C@@](O)(CC(=O)NCCCCNC(=O)C[C@@](O)(CC(=…
ZINC13398039 ZINC 0.577 234.2 Da LogP -0.38 TPSA 121.1 ✓ Ro5 ✓ Clean CC(C)OC(=O)C[C@](O)(CC(=O)O)C(=O)O
ZINC2528012 ZINC 0.577 234.2 Da LogP -0.38 TPSA 121.1 ✓ Ro5 ✓ Clean CC(C)OC(=O)C[C@@](O)(CC(=O)O)C(=O)O
ZINC146315135 ZINC 0.560 204.2 Da LogP 0.86 TPSA 94.8 ✓ Ro5 ✓ Clean CCCCC[C@@](O)(CC(=O)O)C(=O)O
ZINC146315336 ZINC 0.560 204.2 Da LogP 0.86 TPSA 94.8 ✓ Ro5 ✓ Clean CCCCC[C@](O)(CC(=O)O)C(=O)O
ZINC1850353 ZINC 0.556 206.1 Da LogP -0.86 TPSA 132.1 ✓ Ro5 ✓ Clean O=C(O)CC(O)(CC(=O)O)CC(=O)O
ZINC13398014 ZINC 0.522 220.2 Da LogP -1.07 TPSA 110.1 ✓ Ro5 ✓ Clean COC(=O)CC(O)(CC(=O)OC)C(=O)O
ZINC3861629 ZINC 0.522 206.1 Da LogP -1.16 TPSA 121.1 ✓ Ro5 ✓ Clean COC(=O)C(O)(CC(=O)O)CC(=O)O
ZINC100969993 ZINC 0.500 359.5 Da LogP 2.70 TPSA 123.9 ✓ Ro5 ✓ Clean CCCCCCCCCCCCNC(=O)C[C@](O)(CC(=O)O)C(=O)O
ZINC100969996 ZINC 0.500 359.5 Da LogP 2.70 TPSA 123.9 ✓ Ro5 ✓ Clean CCCCCCCCCCCCNC(=O)C[C@@](O)(CC(=O)O)C(=O)O
ZINC1711854 ZINC 0.500 248.2 Da LogP -0.13 TPSA 149.2 ✓ Ro5 ✓ Clean O=C(O)CC(CC(=O)O)(CC(=O)O)CC(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.