Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 52.427 Lower values reduce human off-target concern.
- Human E-value
- 9.21e-24
- Gut microbiome similarity
- 59.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 45.283 Higher values support similarity to known essential genes.
- DEG E-value
- 1.5499999999999998e-67 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 96.74 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASNPEQFLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFISGVGTGGTLTGVSRYIKNTKGKKDLITVAVEPTDSPVIAQALAGEELKPGPHKIQGIGAGFIPGNLDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDEAFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
2- GO:0004124 Catalysis of the reaction: O3-acetyl-L-serine + hydrogen sulfide = L-cysteine + acetate.
- GO:0006535 OBSOLETE. The chemical reactions and pathways resulting in the formation of cysteine from L- serine.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 31 | 49 | ProSitePatterns | PS00901 | Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site. |
| 31 | 49 | InterPro | IPR001216 | Cysteine synthase/cystathionine beta-synthase, pyridoxal-phosphate attachment site |
| 9 | 312 | NCBIfam | TIGR01139 | cysteine synthase A |
| 9 | 312 | InterPro | IPR005859 | Cysteine synthase CysK |
| 12 | 308 | Gene3D | G3DSA:3.40.50.1100 | - |
| 12 | 308 | InterPro | IPR036052 | Tryptophan synthase beta chain-like, PALP domain superfamily |
| 3 | 317 | SUPERFAMILY | SSF53686 | Tryptophan synthase beta subunit-like PLP-dependent enzymes |
| 3 | 317 | InterPro | IPR036052 | Tryptophan synthase beta chain-like, PALP domain superfamily |
| 124 | 308 | FunFam | G3DSA:3.40.50.1100:FF:000009 | Cysteine synthase |
| 43 | 145 | Gene3D | G3DSA:3.40.50.1100 | - |
| 43 | 145 | InterPro | IPR036052 | Tryptophan synthase beta chain-like, PALP domain superfamily |
| 10 | 318 | PANTHER | PTHR10314 | CYSTATHIONINE BETA-SYNTHASE |
| 10 | 312 | NCBIfam | TIGR01136 | cysteine synthase |
| 10 | 312 | InterPro | IPR005856 | Cysteine synthase |
| 10 | 300 | Pfam | PF00291 | Pyridoxal-phosphate dependent enzyme |
| 10 | 300 | InterPro | IPR001926 | Tryptophan synthase beta chain-like, PALP domain |
| 13 | 308 | CDD | cd01561 | CBS_like |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GWF8
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_4750
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 0JO RCSB PDB | P45040 | 316.2 Da LogP 0.72 TPSA 149.5 | ✓ Ro5 | ✓ Clean |
Cc1c(c(c(cn1)COP(=O)(O)O)/C=N/C(=C)C(=O)O)O
|
|
| AA5 RCSB PDB | P47998 | 378.3 Da LogP 1.33 TPSA 149.5 | ✓ Ro5 | ✓ Clean |
Cc1c(c(c(cn1)COP(=O)(O)O)C=N[C@@H](CCSC)C(=O)O)O
|
|
| AWH RCSB PDB | P9WP55 | 412.4 Da LogP 3.08 TPSA 116.5 | ✓ Ro5 | ✓ Clean |
CN\1C(=O)/C(=C/c2ccccc2OCC(=O)O)/S/C1=N\c3cccc(…
|
|
| OAS RCSB PDB | P45040 | 147.1 Da LogP -1.04 TPSA 89.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@@H](C(=O)O)N
|
|
| PDA RCSB PDB | P9WP55 | 320.2 Da LogP 0.27 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
Cc1c(c(c(cn1)COP(=O)(O)O)CNC(C)C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL2418481 ChEMBL | P9WP55 | 7.72 ~19.1 nM | 356.4 Da LogP 3.76 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(F)cc2)S/C1=N\c1cccc(C(=O)O)…
|
| CHEMBL2418529 ChEMBL | P9WP55 | 7.59 ~25.7 nM | 444.5 Da LogP 5.20 TPSA 79.2 | 1 viol. | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(OCc3ccccc3)cc2)S/C1=N\c1ccc…
|
| CHEMBL2418524 ChEMBL | P9WP55 | 7.47 ~33.9 nM | 368.4 Da LogP 3.63 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N\c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| CHEMBL2418487 ChEMBL | P9WP55 | 7.43 ~37.2 nM | 381.5 Da LogP 3.68 TPSA 73.2 | ✓ Ro5 | Alert |
CN1C(=O)/C(=C/c2ccc(N(C)C)cc2)S/C1=N\c1cccc(C(=…
|
| CHEMBL2418504 ChEMBL | P9WP55 | 7.26 ~55.0 nM | 398.4 Da LogP 3.64 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N\c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| CHEMBL2418505 ChEMBL | P9WP55 | 7.25 ~56.2 nM | 412.5 Da LogP 4.03 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C/c2ccc(OC)c(OC)c2)S/C1=N\c1cccc(C…
|
| CHEMBL2418502 ChEMBL | P9WP55 | 7.22 ~60.3 nM | 384.4 Da LogP 3.33 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2\S/C(=N\c3cccc(C(=O)O)c3)N(C)C2=O)c…
|
| CHEMBL2418568 ChEMBL | P9WP55 | 7.20 ~63.1 nM | 354.4 Da LogP 3.32 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(O)cc2)S/C1=N\c1cccc(C(=O)O)…
|
| CHEMBL2418489 ChEMBL | P9WP55 | 7.16 ~69.2 nM | 428.5 Da LogP 3.64 TPSA 97.7 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2\S/C(=N\c3cccc(C(=O)O)c3)N(C)C2=O)c…
|
| CHEMBL2418545 ChEMBL | P9WP55 | 7.02 ~95.5 nM | 382.4 Da LogP 4.10 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
CCCN1C(=O)/C(=C/c2ccc(O)cc2)S/C1=N\c1cccc(C(=O)…
|
| CHEMBL2418569 ChEMBL | P9WP55 | 6.99 ~102.3 nM | 368.4 Da LogP 3.71 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C/c2ccc(O)cc2)S/C1=N\c1cccc(C(=O)O…
|
| CHEMBL2418548 ChEMBL | P9WP55 | 6.96 ~109.6 nM | 380.4 Da LogP 3.88 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
C=CCN1C(=O)/C(=C/c2ccc(O)cc2)S/C1=N\c1cccc(C(=O…
|
| CHEMBL2418551 ChEMBL | P9WP55 | 6.85 ~141.3 nM | 382.4 Da LogP 4.10 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
CC(C)N1C(=O)/C(=C/c2ccc(O)cc2)S/C1=N\c1cccc(C(=…
|
| CHEMBL2418514 ChEMBL | P9WP55 | 6.79 ~162.2 nM | 368.4 Da LogP 3.63 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccccc1/C=C1\S/C(=N\c2cccc(C(=O)O)c2)N(C)C1=O
|
| CHEMBL4858734 ChEMBL | P9WP55 | 6.20 ~631.0 nM | 844.9 Da LogP 1.49 TPSA 257.4 | 3 viol. | Alert |
C[C@@H]1O[C@@H](O[C@@H]2C[C@H](c3ccc4c(c3O)C(=O…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100260795 ZINC | 1.000 | 412.4 Da LogP 3.08 TPSA 116.5 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccccc2OCC(=O)O)S/C1=N/c1cccc(C(…
|
| ZINC4575663 ZINC | 1.000 | 398.4 Da LogP 3.64 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC4599096 ZINC | 1.000 | 384.4 Da LogP 3.33 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)c…
|
| ZINC5065718 ZINC | 1.000 | 381.5 Da LogP 3.68 TPSA 73.2 | ✓ Ro5 | Alert |
CN1C(=O)/C(=C/c2ccc(N(C)C)cc2)S/C1=N/c1cccc(C(=…
|
| ZINC100321212 ZINC | 0.867 | 398.4 Da LogP 3.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C/c2ccc(OC)c(O)c2)S/C1=N/c1cccc(C(…
|
| ZINC100936755 ZINC | 0.867 | 398.4 Da LogP 3.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C/c2ccc(O)c(OC)c2)S/C1=N/c1cccc(C(…
|
| ZINC33684545 ZINC | 0.867 | 398.4 Da LogP 3.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C\c2ccc(O)c(OC)c2)S/C1=N\c1cccc(C(…
|
| ZINC100260846 ZINC | 0.862 | 384.4 Da LogP 3.33 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC4660262 ZINC | 0.860 | 382.4 Da LogP 3.94 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC100309209 ZINC | 0.852 | 461.3 Da LogP 4.78 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C/c2ccc(OC)c(Br)c2)S/C1=N/c1cccc(C…
|
| ZINC6878883 ZINC | 0.850 | 442.4 Da LogP 3.09 TPSA 125.7 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)c…
|
| ZINC100318601 ZINC | 0.845 | 402.9 Da LogP 4.28 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC100928204 ZINC | 0.845 | 447.3 Da LogP 4.39 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC8438503 ZINC | 0.845 | 494.3 Da LogP 4.23 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC100318659 ZINC | 0.844 | 436.5 Da LogP 4.03 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
C#CCOc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(CC)C…
|
| ZINC100260861 ZINC | 0.840 | 338.4 Da LogP 3.62 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccccc2)S/C1=N/c1cccc(C(=O)O)c1
|
| ZINC8642766 ZINC | 0.840 | 338.4 Da LogP 3.62 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccccc2)S/C1=N\c1cccc(C(=O)O)c1
|
| ZINC4698831 ZINC | 0.836 | 368.4 Da LogP 3.63 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1cccc(/C=C2/S/C(=N\c3cccc(C(=O)O)c3)N(C)C2=O…
|
| ZINC83316693 ZINC | 0.828 | 412.4 Da LogP 3.08 TPSA 116.5 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccccc2OCC(=O)O)S/C1=N/c1ccc(C(=…
|
| ZINC100309361 ZINC | 0.827 | 354.4 Da LogP 3.32 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(O)cc2)S/C1=N/c1cccc(C(=O)O)…
|
| ZINC2296453232 ZINC | 0.827 | 354.4 Da LogP 3.32 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
CN1C(=O)C(=Cc2ccc(O)cc2)SC1=Nc1cccc(C(=O)O)c1
|
| ZINC5024864 ZINC | 0.827 | 352.4 Da LogP 3.93 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
Cc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)c…
|
| ZINC6878881 ZINC | 0.825 | 428.5 Da LogP 3.64 TPSA 97.7 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)c…
|
| ZINC100927880 ZINC | 0.820 | 491.3 Da LogP 3.84 TPSA 116.5 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2cc(Br)ccc2OCC(=O)O)S/C1=N/c1ccc…
|
| ZINC4591268 ZINC | 0.820 | 398.4 Da LogP 3.72 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCOc1cc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC100260791 ZINC | 0.817 | 412.4 Da LogP 3.08 TPSA 116.5 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(OCC(=O)O)cc2)S/C1=N/c1cccc(…
|
| ZINC100260761 ZINC | 0.811 | 372.8 Da LogP 4.27 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(Cl)cc2)S/C1=N/c1cccc(C(=O)O…
|
| ZINC8642746 ZINC | 0.811 | 372.8 Da LogP 4.27 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(Cl)cc2)S/C1=N\c1cccc(C(=O)O…
|
| ZINC100927270 ZINC | 0.810 | 384.4 Da LogP 3.33 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2\S/C(=N/c3ccc(C(=O)O)cc3)N(C)C2=O)c…
|
| ZINC6878882 ZINC | 0.810 | 422.5 Da LogP 3.64 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
C#CCOc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2…
|
| ZINC100260755 ZINC | 0.807 | 368.4 Da LogP 3.63 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccccc1/C=C1\S/C(=N/c2cccc(C(=O)O)c2)N(C)C1=O
|
| ZINC1007728 ZINC | 0.804 | 396.4 Da LogP 3.41 TPSA 96.3 | ✓ Ro5 | ✓ Clean |
COC(=O)c1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)…
|
| ZINC4680392 ZINC | 0.804 | 340.4 Da LogP 3.63 TPSA 62.1 | ✓ Ro5 | ✓ Clean |
COc1cc(/C=C2/S/C(=N/c3ccccc3)N(C)C2=O)ccc1O
|
| ZINC97456580 ZINC | 0.804 | 398.4 Da LogP 3.64 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3ccc(C(=O)O)cc3)N(C)C2=O)…
|
| ZINC4466315 ZINC | 0.792 | 336.4 Da LogP 4.18 TPSA 52.9 | ✓ Ro5 | ✓ Clean |
C=CCN1C(=O)/C(=C\c2ccc(O)cc2)S/C1=N/c1ccccc1
|
| ZINC100937907 ZINC | 0.790 | 488.5 Da LogP 4.90 TPSA 116.5 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccccc2OCc2ccc(C(=O)O)cc2)S/C1=N…
|
| ZINC4664355 ZINC | 0.789 | 368.5 Da LogP 4.33 TPSA 51.1 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C\c2ccc(OC)c(OC)c2)S/C1=N/c1ccccc1
|
| ZINC4698651 ZINC | 0.789 | 398.4 Da LogP 3.64 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(OC)c(/C=C2/S/C(=N\c3cccc(C(=O)O)c3)N(C)…
|
| ZINC8399628 ZINC | 0.783 | 426.5 Da LogP 4.42 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
CCOc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O…
|
| ZINC5033940 ZINC | 0.782 | 380.5 Da LogP 4.74 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CC(C)c1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2…
|
| ZINC100215266 ZINC | 0.778 | 381.5 Da LogP 3.68 TPSA 73.2 | ✓ Ro5 | Alert |
CN1C(=O)/C(=C/c2ccc(N(C)C)cc2)S/C1=N/c1ccc(C(=O…
|
| ZINC5558020 ZINC | 0.778 | 368.4 Da LogP 3.63 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3ccc(C(=O)O)cc3)N(C)C2=O)…
|
| ZINC100260866 ZINC | 0.776 | 398.4 Da LogP 3.64 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2\S/C(=N/c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC4691610 ZINC | 0.776 | 382.4 Da LogP 3.94 TPSA 79.2 | ✓ Ro5 | ✓ Clean |
COc1ccc(/C=C2/S/C(=N\c3cccc(C(=O)O)c3)N(C)C2=O)…
|
| ZINC100311577 ZINC | 0.769 | 491.4 Da LogP 4.79 TPSA 88.4 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C/c2cc(Br)c(OC)c(OC)c2)S/C1=N/c1cc…
|
| ZINC100319088 ZINC | 0.769 | 432.9 Da LogP 4.38 TPSA 99.4 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C/c2cc(Cl)c(O)c(OC)c2)S/C1=N/c1ccc…
|
| ZINC100931254 ZINC | 0.769 | 356.4 Da LogP 3.76 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(F)cc2)S/C1=N/c1ccc(C(=O)O)c…
|
| ZINC100309245 ZINC | 0.768 | 370.4 Da LogP 4.15 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C/c2ccc(F)cc2)S/C1=N/c1cccc(C(=O)O…
|
| ZINC4949945 ZINC | 0.768 | 370.4 Da LogP 4.15 TPSA 70.0 | ✓ Ro5 | ✓ Clean |
CCN1C(=O)/C(=C\c2ccc(F)cc2)S/C1=N\c1cccc(C(=O)O…
|
| ZINC100260872 ZINC | 0.767 | 388.8 Da LogP 3.98 TPSA 90.2 | ✓ Ro5 | ✓ Clean |
CN1C(=O)/C(=C/c2ccc(O)c(Cl)c2)S/C1=N/c1cccc(C(=…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.