KpATCC43816 Protein target profile

amino ABC transporter, permease, 3-TM region, His/Glu/Gln/Arg/opine family domain protein

Accession: VK055_4817

Gene: AIK83344.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GT46
Length 238
Pocket druggability (P2Rank · AlphaFold DB model) 0.133
Functional annotation 0 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
94.421 Higher values support similarity to known essential genes.
DEG E-value
9.38e-164 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
91.51 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.133
Structure A0A0H3GT46
Pocket Pocket 1
Druggability (FPocket) 0.704
Structure A0A0H3GT46
Pocket Pocket 8
ColabFold model
P2Rank 0.157 · Pocket 1
FPocket 0.904 · Pocket 13
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 100 / 4744 genomes with a hit
Prevalence 2.1%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MIEIIQEYWKSLLWTDGYRFTGVAITLWLLISSVVMGGILAVFLAIGRVSSNKFIQFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTELLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPAGEIEAARAYGFSSVKLYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAFGIAAVLYLIISYVLISLFRKAEKRWLQHIKPSSTH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

6
  • GO:0043190 A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0071705 The directed movement of nitrogen-containing compounds into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0006865 The directed movement of amino acids, organic acids containing one or more amino substituents, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
48 58 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
7 230 Gene3D G3DSA:1.10.3720.10 -
7 230 InterPro IPR035906 MetI-like superfamily
21 122 NCBIfam TIGR01726 ABC transporter permease subunit, His/Glu/Gln/Arg/opine family, N-terminal region
21 122 InterPro IPR010065 Amino acid ABC transporter, permease protein, 3-TM domain
1 19 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
59 79 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
23 221 ProSiteProfiles PS50928 ABC transporter integral membrane type-1 domain profile.
23 221 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
25 218 CDD cd06261 TM_PBP2
25 218 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
25 47 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
57 79 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
7 230 FunFam G3DSA:1.10.3720.10:FF:000012 Histidine ABC transporter permease HisM
200 221 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
199 221 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
37 220 Pfam PF00528 Binding-protein-dependent transport system inner membrane component
37 220 InterPro IPR000515 ABC transporter type 1, transmembrane domain MetI-like
20 47 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
5 227 PANTHER PTHR30450 ABC TRANSPORTER PERMEASE
167 189 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
17 220 SUPERFAMILY SSF161098 MetI-like
17 220 InterPro IPR035906 MetI-like superfamily
222 238 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
80 199 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.133
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.046
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.042
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.034
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #8
0.704
Show in viewer
Surrounding area
Pocket 2 FPocket #12
0.63
Show in viewer
Surrounding area
Pocket 3 FPocket #17
0.502
Show in viewer
Surrounding area
Pocket 4 FPocket #5
0.215
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GT46
AlphaFold DB full sequence Viewing
ColabFold VK055_4817
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.