KpATCC43816 Protein target profile
elongation factor P (EF-P) OB domain protein
Accession: VK055_4918
Target candidate with partial support; inspect missing evidence before prioritizing.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 52.91 Higher values support similarity to known essential genes.
- DEG E-value
- 1.15e-72 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 93.32 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MPRANEIKKGMVLNYNGKLLIVKNIDIQSPSARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRFVDFSYVDGNEYVFMDKEDYTPYTFTKEQIEEELQFIPEGGMPDMQVLTWDGQLLALELPQTVDLEIIETAPGIKGASASSRTKPATMSTGLVIQVPEYLTTGEKIRIHIEECRYMGRAD
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
5- GO:0003746 Functions in chain elongation during polypeptide synthesis at the ribosome.
- GO:0043043 The chemical reactions and pathways resulting in the formation of peptides, compounds of 2 or more (but usually less than 100) amino acids where the alpha carboxyl group of one is bound to the alpha amino group of another. This may include the translation of a precursor protein and its subsequent processing into a functional peptide.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0006414 The successive addition of amino acid residues to a nascent polypeptide chain during protein biosynthesis.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 65 | SUPERFAMILY | SSF50104 | Translation proteins SH3-like domain |
| 1 | 65 | InterPro | IPR008991 | Translation protein SH3-like domain superfamily |
| 66 | 130 | FunFam | G3DSA:2.40.50.140:FF:000053 | Elongation factor P-like protein |
| 1 | 64 | FunFam | G3DSA:2.30.30.30:FF:000011 | Elongation factor P-like protein |
| 72 | 124 | Pfam | PF01132 | Elongation factor P (EF-P) OB domain |
| 72 | 124 | InterPro | IPR001059 | Translation elongation factor P/YeiP, central |
| 133 | 188 | SMART | SM00841 | Elong_fact_P_C_2 |
| 133 | 188 | InterPro | IPR015365 | Elongation factor P, C-terminal |
| 4 | 62 | Pfam | PF08207 | Elongation factor P (EF-P) KOW-like domain |
| 4 | 62 | InterPro | IPR013185 | Translation elongation factor, KOW-like |
| 1 | 64 | Gene3D | G3DSA:2.30.30.30 | - |
| 1 | 64 | InterPro | IPR014722 | Ribosomal protein L2, domain 2 |
| 66 | 130 | Gene3D | G3DSA:2.40.50.140 | - |
| 66 | 130 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
| 154 | 173 | ProSitePatterns | PS01275 | Elongation factor P signature. |
| 154 | 173 | InterPro | IPR013852 | Translation elongation factor P/YeiP, conserved site |
| 3 | 189 | PANTHER | PTHR30053 | ELONGATION FACTOR P |
| 3 | 189 | InterPro | IPR020599 | Translation elongation factor P/YeiP |
| 68 | 130 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins |
| 68 | 130 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
| 2 | 189 | Hamap | MF_00646 | Elongation factor P-like protein [yeiP]. |
| 2 | 189 | InterPro | IPR011897 | Translation elongation factor P-like, YeiP |
| 132 | 189 | SUPERFAMILY | SSF50249 | Nucleic acid-binding proteins |
| 132 | 189 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
| 133 | 188 | CDD | cd05794 | S1_EF-P_repeat_2 |
| 132 | 190 | Gene3D | G3DSA:2.40.50.140 | - |
| 132 | 190 | InterPro | IPR012340 | Nucleic acid-binding, OB-fold |
| 69 | 125 | SMART | SM01185 | EFP_2 |
| 69 | 125 | InterPro | IPR001059 | Translation elongation factor P/YeiP, central |
| 68 | 130 | CDD | cd04470 | S1_EF-P_repeat_1 |
| 68 | 130 | InterPro | IPR001059 | Translation elongation factor P/YeiP, central |
| 1 | 190 | PIRSF | PIRSF005901 | EF-P |
| 1 | 190 | InterPro | IPR020599 | Translation elongation factor P/YeiP |
| 132 | 190 | FunFam | G3DSA:2.40.50.140:FF:000004 | Elongation factor P |
| 3 | 189 | NCBIfam | TIGR02178 | elongation factor P-like protein YeiP |
| 3 | 189 | InterPro | IPR011897 | Translation elongation factor P-like, YeiP |
| 133 | 188 | Pfam | PF09285 | Elongation factor P, C-terminal |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Residue sets
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GVI2
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_4918
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC168710640 ZINC | 0.809 | 474.5 Da LogP -4.00 TPSA 260.9 | 2 viol. | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)NS(=O)(=O)OC[C@H]1O[C@@H](…
|
| ZINC168710738 ZINC | 0.809 | 474.5 Da LogP -4.00 TPSA 260.9 | 2 viol. | ✓ Clean |
NC(=O)CC[C@H](N)C(=O)NS(=O)(=O)OC[C@H]1O[C@@H](…
|
| ZINC1083817667 ZINC | 0.768 | 459.5 Da LogP -2.22 TPSA 217.8 | 1 viol. | ✓ Clean |
CC(C)C[C@@H](N)C(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n…
|
| ZINC936069053 ZINC | 0.768 | 459.5 Da LogP -2.22 TPSA 217.8 | 1 viol. | ✓ Clean |
CC(C)C[C@@H](N)C(=O)NS(=O)(=O)OC[C@@H]1O[C@H](n…
|
| ZINC14967098 ZINC | 0.731 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC218033334 ZINC | 0.731 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC218033425 ZINC | 0.731 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC218033503 ZINC | 0.731 | 403.4 Da LogP -3.64 TPSA 217.8 | 1 viol. | ✓ Clean |
NCC(=O)NS(=O)(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc…
|
| ZINC936069043 ZINC | 0.718 | 459.5 Da LogP -2.22 TPSA 217.8 | 1 viol. | ✓ Clean |
CC[C@@H](C)[C@@H](N)C(=O)NS(=O)(=O)OC[C@@H]1O[C…
|
| ZINC4824650 ZINC | 0.653 | 394.4 Da LogP -2.40 TPSA 200.5 | 2 viol. | ✓ Clean |
NCCCC[C@@H](N)C(=O)N[C@@H]1[C@H](CO)O[C@H](n2cn…
|
| ZINC4824652 ZINC | 0.653 | 394.4 Da LogP -2.40 TPSA 200.5 | 2 viol. | ✓ Clean |
NCCCC[C@@H](N)C(=O)N[C@@H]1[C@H](CO)O[C@@H](n2c…
|
| ZINC4824654 ZINC | 0.653 | 394.4 Da LogP -2.40 TPSA 200.4 | 2 viol. | ✓ Clean |
NCCCC[C@@H](N)C(=O)N[C@H]1[C@H](O)[C@@H](n2cnc3…
|
| ZINC4824655 ZINC | 0.653 | 394.4 Da LogP -2.40 TPSA 200.4 | 2 viol. | ✓ Clean |
NCCCC[C@@H](N)C(=O)N[C@H]1[C@H](O)[C@H](n2cnc3c…
|
| ZINC12405780 ZINC | 0.646 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@@H]…
|
| ZINC12502832 ZINC | 0.646 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@@H]…
|
| ZINC79460727 ZINC | 0.646 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@H](…
|
| ZINC79460732 ZINC | 0.646 | 346.3 Da LogP -2.75 TPSA 188.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(N)(=O)=O)[C@H](…
|
| ZINC14967079 ZINC | 0.600 | 461.4 Da LogP -2.95 TPSA 258.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COS(=O)(=O)/N=C(\O)…
|
| ZINC31260554 ZINC | 0.597 | 474.5 Da LogP -3.16 TPSA 264.4 | 2 viol. | ✓ Clean |
NC(=O)CC[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H…
|
| ZINC31976683 ZINC | 0.597 | 474.5 Da LogP -3.16 TPSA 264.4 | 2 viol. | ✓ Clean |
NC(=O)CC[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H…
|
| ZINC13547650 ZINC | 0.597 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@H](O)…
|
| ZINC4823971 ZINC | 0.597 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O…
|
| ZINC4823975 ZINC | 0.597 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](…
|
| ZINC4823980 ZINC | 0.597 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](O…
|
| ZINC4823984 ZINC | 0.597 | 309.3 Da LogP -1.41 TPSA 145.6 | ✓ Ro5 | ✓ Clean |
CC(=O)OC[C@@H]1O[C@@H](n2cnc3c(N)ncnc32)[C@@H](…
|
| ZINC24951137 ZINC | 0.581 | 417.4 Da LogP -2.41 TPSA 221.3 | 1 viol. | ✓ Clean |
C[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H](n2cnc…
|
| ZINC33821383 ZINC | 0.571 | 459.5 Da LogP -1.38 TPSA 221.3 | 1 viol. | ✓ Clean |
CC(C)C[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@@H](…
|
| ZINC49014951 ZINC | 0.569 | 416.4 Da LogP -2.76 TPSA 216.8 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CS(=O)(=O)CC[C@H](N)…
|
| ZINC49014955 ZINC | 0.569 | 416.4 Da LogP -2.76 TPSA 216.8 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CS(=O)(=O)CC[C@@H](N…
|
| ZINC1574270 ZINC | 0.568 | 421.4 Da LogP -0.26 TPSA 162.7 | 1 viol. | ✓ Clean |
Cc1ccc(S(=O)(=O)OC[C@@H]2O[C@H](n3cnc4c(N)ncnc4…
|
| ZINC3861767 ZINC | 0.568 | 421.4 Da LogP -0.26 TPSA 162.7 | 1 viol. | ✓ Clean |
Cc1ccc(S(=O)(=O)OC[C@H]2O[C@@H](n3cnc4c(N)ncnc4…
|
| ZINC5487110 ZINC | 0.568 | 425.6 Da LogP -0.00 TPSA 171.3 | 1 viol. | ✓ Clean |
NCCCCC[C@@H](CCN)SC[C@@H]1O[C@H](n2cnc3c(N)ncnc…
|
| ZINC5487111 ZINC | 0.568 | 425.6 Da LogP -0.00 TPSA 171.3 | 1 viol. | ✓ Clean |
NCCCCC[C@@H](CCN)SC[C@@H]1O[C@@H](n2cnc3c(N)ncn…
|
| ZINC5487114 ZINC | 0.568 | 425.6 Da LogP -0.00 TPSA 171.3 | 1 viol. | ✓ Clean |
NCCCCC[C@@H](CCN)SC[C@@H]1O[C@H](n2cnc3c(N)ncnc…
|
| ZINC5487117 ZINC | 0.568 | 425.6 Da LogP -0.00 TPSA 171.3 | 1 viol. | ✓ Clean |
NCCCCC[C@@H](CCN)SC[C@@H]1O[C@@H](n2cnc3c(N)ncn…
|
| ZINC13518964 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC1532515 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC1571045 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC1842158 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@H](O…
|
| ZINC2046931 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@H](…
|
| ZINC2126310 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3201891 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C@@H]…
|
| ZINC3201893 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3830180 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3860156 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC3977897 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC4806442 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC8613167 ZINC | 0.565 | 347.2 Da LogP -1.86 TPSA 186.1 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC13488353 ZINC | 0.558 | 459.5 Da LogP -1.38 TPSA 221.3 | 1 viol. | ✓ Clean |
CC[C@H](C)[C@H](N)/C(O)=N/S(=O)(=O)OC[C@H]1O[C@…
|
| ZINC13522400 ZINC | 0.556 | 400.4 Da LogP -2.42 TPSA 199.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[S@](=O)CC[C@H](N)…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.