KpATCC43816 Protein target profile

PRD domain protein

Accession: VK055_4944

Gene: AIK83470.1 3D evidence: AlphaFold DB model + ColabFold model Metabolism Not in network UniProt A0A0H3GQW6
Export view
Length 277
Pocket druggability (P2Rank · AlphaFold DB model) 0.142
Functional annotation 0 EC 3 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 55 of 4744 screened genomes (1.2%) have a significant similarity hit. Weak predicted binding pocket FPocket selected-pocket score 0.23. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.14.

Evidence gaps

No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.2% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
32.364 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
93.01 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.142
Structure A0A0H3GQW6
Pocket Pocket 1
Druggability (FPocket) 0.229
Structure A0A0H3GQW6
Pocket Pocket 14
ColabFold model
P2Rank 0.237 · Pocket 1
FPocket 0.415 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 55 / 4744 genomes with a hit
Prevalence 1.2%

Metabolic context

Reactions catalyzed, pathway membership, and centrality in the genome-scale metabolic network.

This protein is not associated with the imported metabolic network for this genome.

Browse the genome's metabolic network

Imported from KpATCC43816.sbml · 2026-07-09

Sequence

Primary amino-acid sequence viewer.

MQIAKVLNNNVVVVLDEHRREQVVMGRGLAFQKRPGDVLDDSKIEKVFALQSDELVGRLGELLSQIPLEVMTTCDRIIDLARGRLGKLQESLYITLTDHCHFAIERQKKGIALRNVLLWEIKRLYPKEFALGQEARAIIAKRLGVELAEDEAGFIALHLVTAQLNSEMPEVMHVTRVMQEILQLVKYQLQLNYDEESLSYQRFVTHLKFFAQRMLTRTVVEDDDVSLHSAVKDNYAKAWKCAETVATHLQKQYQRSLTTEEIMFLAIHIERVRKEGR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

3
  • GO:0045893 Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0003723 Binding to an RNA molecule or a portion thereof.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
64 166 Gene3D G3DSA:1.10.1790.10 PRD domain
97 109 ProSitePatterns PS00654 PRD domain signature.
97 109 InterPro IPR001550 Transcription antiterminator, conserved site
87 161 Pfam PF00874 PRD domain
87 161 InterPro IPR011608 PRD domain
179 271 Pfam PF00874 PRD domain
179 271 InterPro IPR011608 PRD domain
59 166 SUPERFAMILY SSF63520 PTS-regulatory domain, PRD
59 166 InterPro IPR036634 PRD domain superfamily
167 275 Gene3D G3DSA:1.10.1790.10 PRD domain
2 273 PANTHER PTHR30185 CRYPTIC BETA-GLUCOSIDE BGL OPERON ANTITERMINATOR
65 169 ProSiteProfiles PS51372 PRD domain profile.
65 169 InterPro IPR011608 PRD domain
170 277 ProSiteProfiles PS51372 PRD domain profile.
170 277 InterPro IPR011608 PRD domain
1 54 SUPERFAMILY SSF50151 SacY-like RNA-binding domain
1 54 InterPro IPR036650 CAT RNA-binding domain superfamily
170 273 SUPERFAMILY SSF63520 PTS-regulatory domain, PRD
170 273 InterPro IPR036634 PRD domain superfamily
1 54 Pfam PF03123 CAT RNA binding domain
1 54 InterPro IPR004341 CAT RNA-binding domain
1 54 Gene3D G3DSA:2.30.24.10 -
1 59 SMART SM01061 CAT_RBD_2
1 59 InterPro IPR004341 CAT RNA-binding domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.142
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.028
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.017
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.013
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.0
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #14
0.229
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GQW6
AlphaFold DB — — full sequence — Viewing
ColabFold VK055_4944
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GQW6