Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Evidence coverage
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 37.624 Lower values reduce human off-target concern.
- Human E-value
- 2.91e-42
- Gut microbiome similarity
- 7.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 68.159 Higher values support similarity to known essential genes.
- DEG E-value
- 6.6999999999999994e-105 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 95.5 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTDMSHQCVIVGIAGASASGKSLIASTLYRELREQVGDEHIGVIPEDSYYKDQSHLSMEERVKTNYDHPSSMDHSLLFQHLQMLKSGQPIELPVYSYVEHTRTPNTIHVEPKKVIILEGILLLTDARLRNELNFSIFVDTPLDICLMRRIKRDVNERGRSMDSVMAQYQKTVRPMFLQFIEPSKQYADIIVPRGGKNRIAIDILKAKISQFFE
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
8- GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
- GO:0016773 Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to an alcohol group (acceptor).
- GO:0016301 Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
- GO:0004849 Catalysis of the reaction: ATP + uridine = ADP + UMP.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0043771 Catalysis of the reaction: ATP + cytidine = ADP + CMP.
- GO:0044211 Any process which produces cytidine 5'-triphosphate (CTP) from derivatives of it, without de novo synthesis.
- GO:0044206 Any process which produces UMP, uridine monophosphate, from derivatives of it (e.g. cytidine, uridine, cytosine) without de novo synthesis.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 10 | 208 | CDD | cd02023 | UMPK |
| 10 | 208 | InterPro | IPR000764 | Uridine kinase-like |
| 1 | 20 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 10 | 199 | Pfam | PF00485 | Phosphoribulokinase / Uridine kinase family |
| 10 | 199 | InterPro | IPR006083 | Phosphoribulokinase/uridine kinase |
| 5 | 213 | Hamap | MF_00551 | Uridine kinase [udk]. |
| 5 | 213 | InterPro | IPR026008 | Uridine kinase |
| 16 | 20 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 7 | 213 | FunFam | G3DSA:3.40.50.300:FF:000252 | Uridine kinase |
| 1 | 7 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 5 | 213 | Gene3D | G3DSA:3.40.50.300 | - |
| 5 | 213 | InterPro | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
| 9 | 190 | PANTHER | PTHR10285 | URIDINE KINASE |
| 8 | 205 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases |
| 8 | 205 | InterPro | IPR027417 | P-loop containing nucleoside triphosphate hydrolase |
| 21 | 213 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 8 | 15 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 157 | 168 | PRINTS | PR00988 | Uridine kinase signature |
| 8 | 25 | PRINTS | PR00988 | Uridine kinase signature |
| 87 | 102 | PRINTS | PR00988 | Uridine kinase signature |
| 143 | 153 | PRINTS | PR00988 | Uridine kinase signature |
| 179 | 192 | PRINTS | PR00988 | Uridine kinase signature |
| 42 | 53 | PRINTS | PR00988 | Uridine kinase signature |
| 6 | 213 | NCBIfam | TIGR00235 | uridine kinase |
| 6 | 213 | InterPro | IPR000764 | Uridine kinase-like |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GVV7
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
VK055_5008
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 0JR RCSB PDB | B5XYG3 | 309.4 Da LogP -0.42 TPSA 111.6 | ✓ Ro5 | ✓ Clean |
CC(C)(CO)[C@H](C(=O)NCCC(=O)NCc1cccnc1)O
|
|
| ACP RCSB PDB | Q5SKR5 | 505.2 Da LogP -1.52 TPSA 269.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| CTN RCSB PDB | Q5SKR5 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
C1=CN(C(=O)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
|
| DTT RCSB PDB | Q31PL2 | 154.3 Da LogP -0.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C([C@@H]([C@H](CS)O)O)S
|
|
| G6P RCSB PDB | Q31PL2 | 260.1 Da LogP -3.10 TPSA 156.9 | 1 viol. | ✓ Clean |
C([C@@H]1[C@H]([C@@H]([C@H]([C@H](O1)O)O)O)O)OP…
|
|
| KEA RCSB PDB | Q9BZX2 | 348.2 Da LogP -1.13 TPSA 205.9 | ✓ Ro5 | Alert |
C1=CN(C(=O)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
|
| OS RCSB PDB | A0A0H3K6J7 | 190.2 Da LogP -0.00 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
[Os+3]
|
|
| P6D RCSB PDB | Q9BZX2 | — | — | — |
C1=CN(C(=O)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
|
| PN4 RCSB PDB | B5XYG3 | 288.4 Da LogP 0.18 TPSA 98.7 | ✓ Ro5 | ✓ Clean |
CCCCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO)O
|
|
| SH2 RCSB PDB | B5XYG3 | 366.4 Da LogP -0.04 TPSA 117.1 | ✓ Ro5 | ✓ Clean |
CC(C)(CO)[C@H](C(=O)NCCC(=O)NCCc1ccc2c(c1)OCO2)O
|
|
| UZ0 RCSB PDB | Q9BZX2 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
C1=CN(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
|
| UZR RCSB PDB | Q9BZX2 | 350.2 Da LogP -2.18 TPSA 201.4 | ✓ Ro5 | Alert |
C1=CN(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL1592234 ChEMBL | Q9BZX2 | 6.00 ~1.0 µM | 497.6 Da LogP 5.89 TPSA 101.4 | 1 viol. | ✓ Clean |
Cc1ccc(-c2nc3c(c(SCC(=O)Nc4cccc(C(=O)O)c4)n2)Cc…
|
| CHEMBL4787313 ChEMBL | Q9BZX2 | — | 715.3 Da LogP 0.35 TPSA 129.5 | 1 viol. | ✓ Clean |
COc1c(OCCOCCOCCNC(=O)CCCC[C@@H]2SC[C@@H]3NC(=O)…
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1078621 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC12336757 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC12336758 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC146563393 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@H]1[C@@H](O)[C@@H](CO)O[C@H]1n1cc…
|
| ZINC16969357 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC17261182 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@H]1[C@H](O)[C@@H](CO)O[C@@H]1n1cc…
|
| ZINC230402123 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@H]1[C@@H](n2ccc(=O)[nH]c2=O)O[C@H…
|
| ZINC230402126 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@@H]1[C@@H](n2ccc(=O)[nH]c2=O)O[C@…
|
| ZINC230402130 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@@H]1[C@H](O)[C@@H](CO)O[C@@H]1n1c…
|
| ZINC2583632 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC3795098 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@@H]2O)c(=O)…
|
| ZINC3830623 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@@H](O)[C@H]2O)c(=O)n1
|
| ZINC3830624 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@@H](O)[C@H]2O)c(=O)…
|
| ZINC3978018 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@@H](O)[C@@H]2O)c(=O)n1
|
| ZINC4521169 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@@H]1[C@H](O)[C@H](CO)O[C@@H]1n1cc…
|
| ZINC4521170 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@@H]1[C@H](O)[C@H](CO)O[C@H]1n1ccc…
|
| ZINC4521171 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@H]1[C@H](O)[C@H](CO)O[C@@H]1n1ccc…
|
| ZINC4521172 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@H]1[C@H](O)[C@H](CO)O[C@H]1n1ccc(…
|
| ZINC6091560 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1n1cc…
|
| ZINC6091575 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC6234828 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC6524892 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@H](O)[C@H]2O)c(=O)n1
|
| ZINC83301154 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@@H]1[C@@H](n2ccc(=O)[nH]c2=O)O[C@…
|
| ZINC895248 ZINC | 1.000 | 243.2 Da LogP -2.56 TPSA 130.8 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@@H]2O)c(=O)n1
|
| ZINC90697708 ZINC | 1.000 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@@H]1[C@@H](O)[C@@H](CO)O[C@H]1n1c…
|
| ZINC34268101 ZINC | 0.848 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@@H]1[C@H](CO)O[C@H](n2ccc(=O)[nH]…
|
| ZINC34268103 ZINC | 0.848 | 269.2 Da LogP -1.53 TPSA 153.3 | ✓ Ro5 | Alert |
[N-]=[N+]=N[C@H]1[C@H](O)[C@@H](n2ccc(=O)[nH]c2…
|
| ZINC12360002 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC4806433 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC53683898 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586020 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586021 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC8586022 ZINC | 0.839 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC34085615 ZINC | 0.829 | 242.2 Da LogP -2.60 TPSA 136.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2N)c(=O)n1
|
| ZINC13546396 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@H]2F)c(=O)n1
|
| ZINC16952044 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@H]2F)c(=O)n1
|
| ZINC17174505 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@@H](O)[C@@H]2F)c(=O…
|
| ZINC17174506 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@@H]2F)c(=O)…
|
| ZINC2522524 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@H](O)[C@@H]2F)c(=O)n1
|
| ZINC3817231 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@@H](O)[C@H]2F)c(=O)n1
|
| ZINC57331 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@@H](CO)[C@@H](O)[C@H]2F)c(=O)…
|
| ZINC5758597 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@@H](O)[C@H]2F)c(=O)n1
|
| ZINC5758598 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@H]2O[C@@H](CO)[C@@H](O)[C@@H]2F)c(=O)…
|
| ZINC59201305 ZINC | 0.810 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](O)[C@@H]2F)c(=O)n1
|
| ZINC85475812 ZINC | 0.786 | 245.2 Da LogP -1.59 TPSA 110.6 | ✓ Ro5 | ✓ Clean |
Nc1ccn([C@@H]2O[C@H](CO)[C@H](F)[C@H]2O)c(=O)n1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.