KpKP13 Protein target profile

Bacterial surface antigen (D15)- containing protein

Accession: KP13_00054

Gene: AHE41978.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GV78
Export view
Length 377
Pocket druggability (P2Rank · AlphaFold DB model) 0.899
Functional annotation 0 EC 1 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Independent pocket support: P2Rank + FPocket Both predictors report a high-scoring binding site (P2Rank 0.90, FPocket 0.86). Use the 3D pocket comparison to verify whether they identify the same site. No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.86. This is a computational pocket signal, not binding validation. Second pocket predictor agrees P2Rank predicted binding-site probability 0.90. Review the complete evidence below

Risks to review

Microbiome similarity 27 of 4744 screened genomes (0.6%) have a significant similarity hit. This target also has a predicted binding pocket (P2Rank 0.90) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
91.06 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.899
Structure A0A0H3GV78
Pocket Pocket 1
Druggability (FPocket) 0.861
Structure A0A0H3GV78
Pocket Pocket 31
ColabFold model
P2Rank 0.915 · Pocket 1
FPocket 0.92 · Pocket 32
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 27 / 4744 genomes with a hit
Prevalence 0.6%

Sequence

Primary amino-acid sequence viewer.

MSRLFITFLLLMVCPTGSQAEALSREKIDGWLQHLGASDKFDASKGIDWGVMPGPFYTPELGLGIGTAVVGLYRPDPQDTTSQNSTLTLSGYASSTGAFGLNVKNYTFFDRDLWRVFVDGSIANTPTYYWGQGFHAGDKDNEKEKYTAQVLTLRPTLYRQLIDHVYLGAGWSLAAQNADEMDHDDRPKIENTPQGPSVFSSGASIDINWDDRDFVPNPRRGQYANLRYTHYAPGLGSDTRFEEFQPHYSHYHALSEKSVLAWEADGAFTQGEVPWSMMPLLGSDERMRGYYQGRYRDKNVVSGQLEYRRQLTWRHGIVAWAGAGTMGPSLSSLNNGRWLPSAGVGYRFEFKPRVNVRLDYGIGNGSSGFYFQVGEAF

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

1
  • GO:0019867 The external membrane of Gram-negative bacteria or certain organelles such as mitochondria and chloroplasts; freely permeable to most ions and metabolites.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
73 376 Gene3D G3DSA:2.40.160.50 membrane protein fhac: a member of the omp85/tpsb transporter family
1 20 SignalP_EUK SignalP-noTM SignalP-noTM
1 20 Phobius SIGNAL_PEPTIDE Signal peptide region
4 14 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 20 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
21 377 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
15 20 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
107 377 Pfam PF01103 Omp85 superfamily domain
107 377 InterPro IPR000184 Bacterial surface antigen (D15)

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.899
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.855
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.457
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.312
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.275
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #31
0.861
Show in viewer
Surrounding area
Pocket 2 FPocket #2
0.825
Show in viewer
Surrounding area
Pocket 3 FPocket #6
0.465
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GV78
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_00054
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GV78