Genome KpKP13

Protein target profile

Transcriptional regulatory protein uhpA

Accession: KP13_00083

Gene: uhpA AHE42008.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3H0E2
Length 197
Pocket druggability (P2Rank · AlphaFold DB model) 0.02
Direct ligand evidence 0 54 total records
Functional annotation 0 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
1.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
91.48 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.02
Structure A0A0H3H0E2
Pocket Pocket 1
Druggability (FPocket) 0.205
Structure A0A0H3H0E2
Pocket Pocket 2
ColabFold model
P2Rank 0.004 · Pocket 1
FPocket 0.512 · Pocket 3
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 84 / 4744 genomes with a hit
Prevalence 1.8%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MTTIALIDDHLIVRSGFAQLLGLEADFQVVAEFGSGREALTGLPGRGVQVCICDISMPDISGLELLSQLPKGMATIMLSVHDSPALIEQALNAGARGFLSKRCSPDELIAAVRTVAAGGCYLTPDIAIKLAAGRQDPLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLLEKLGVSNDVELARRMFDSWQ

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

4
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0000160 A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

31 records
Show feature table
Start End DB Term Name
152 168 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
152 168 InterPro IPR000792 Transcription regulator LuxR, C-terminal
138 152 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
138 152 InterPro IPR000792 Transcription regulator LuxR, C-terminal
168 180 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
168 180 InterPro IPR000792 Transcription regulator LuxR, C-terminal
4 117 CDD cd17535 REC_NarL-like
3 116 ProSiteProfiles PS50110 Response regulatory domain profile.
3 116 InterPro IPR001789 Signal transduction response regulator, receiver domain
3 195 Gene3D G3DSA:3.40.50.2300 -
2 194 FunFam G3DSA:3.40.50.2300:FF:000040 DNA-binding transcriptional activator UhpA
1 125 SUPERFAMILY SSF52172 CheY-like
1 125 InterPro IPR011006 CheY-like superfamily
3 191 PANTHER PTHR43214 TWO-COMPONENT RESPONSE REGULATOR
3 191 InterPro IPR039420 Transcriptional regulatory protein WalR-like
130 193 SUPERFAMILY SSF46894 C-terminal effector domain of the bipartite response regulators
130 193 InterPro IPR016032 Signal transduction response regulator, C-terminal effector
2 112 SMART SM00448 REC_2
2 112 InterPro IPR001789 Signal transduction response regulator, receiver domain
136 191 Pfam PF00196 Bacterial regulatory proteins, luxR family
136 191 InterPro IPR000792 Transcription regulator LuxR, C-terminal
138 194 CDD cd06170 LuxR_C_like
138 194 InterPro IPR000792 Transcription regulator LuxR, C-terminal
135 192 SMART SM00421 luxrmega5
135 192 InterPro IPR000792 Transcription regulator LuxR, C-terminal
152 179 ProSitePatterns PS00622 LuxR-type HTH domain signature.
152 179 InterPro IPR000792 Transcription regulator LuxR, C-terminal
131 196 ProSiteProfiles PS50043 LuxR-type HTH domain profile.
131 196 InterPro IPR000792 Transcription regulator LuxR, C-terminal
4 113 Pfam PF00072 Response regulator receiver domain
4 113 InterPro IPR001789 Signal transduction response regulator, receiver domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.02
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2
0.205
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3H0E2
AlphaFold DB full sequence Viewing
ColabFold KP13_00083
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 4 records from similar proteins
Structural ligands 4 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
15P PDB via homolog 1529.8 Da · LogP 0.17 · TPSA 334.1 Open detail RCSB PDB
4QT PDB via homolog Detail RCSB PDB
BEF PDB via homolog Detail RCSB PDB
PE4 PDB via homolog Detail RCSB PDB
ZINC1580161 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
15P RCSB PDB P10958 1529.8 Da LogP 0.17 TPSA 334.1 2 viol. ✓ Clean COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO…
4QT RCSB PDB Q8DNC2 393.8 Da LogP 3.26 TPSA 84.9 ✓ Ro5 ✓ Clean c1(c(c(c(c(c1Br)OO)Br)OO)Br)N
BEF RCSB PDB O34723 66.0 Da LogP 0.88 TPSA 0.0 ✓ Ro5 ✓ Clean [Be-](F)(F)F
PE4 RCSB PDB P58663 354.4 Da LogP 0.11 TPSA 84.8 ✓ Ro5 ✓ Clean CCOCCOCCOCCOCCOCCOCCOCCO

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.