Protein target profile

KP13_00086

Hexose phosphate transport protein

Genome: KpKP13 Gene: uhpT AHE42011.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GXN0
Length 463
Pocket druggability 0.762
Direct ligand evidence 0 58 total records
Functional annotation 0 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
23.204 Lower values reduce human off-target concern.
Human E-value
2.29e-08
Gut microbiome similarity
1.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Localization

Localization
CytoplasmicMembrane

Structure confidence

ColabFold pLDDT
91.09 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.762
Structure A0A0H3GXN0
Pocket Pocket 17
P2Rank 0.972
Structure A0A0H3GXN0
Pocket Pocket 1
ColabFold model
FPocket 0.869 · Pocket 24
P2Rank 0.976 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 66 / 4744 genomes with a hit
Prevalence 1.4%

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

Primary amino-acid sequence viewer.

MLAFLNQVRKPTLDLPLDVRRKMWFKPFMQSYLVVFIGYLTMYLIRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVGKTLVSYYADGKNTKQFLPFMLILSAICMLGFSASMGAGSTSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFLGFWNISHNLGGAGAAGVALFGANYLFDGHVIGMFIFPSIIALIVGFIGLRYGSDSPESYGLGTAEELFGEAISEEDKETEENAMTKWQIFVEYVLKNKVIWLLCFSNIFLYVVRIGIDQWSTVYAFQELKLSKEVAIQGFTLFEVGALVGTLLWGWLSDLANGRRALVACIALALIIATLGVYQHASNQYVYLASLFALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIGDSFAKLGLGMIADGTPVFGLTGWAGTFAALDAAAVGCICLMAIVAIFEERKIRREKKNRILQTA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
  • GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0061513 Enables the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: glucose 6-phosphate(out) + phosphate(in) = glucose 6-phosphate(in) + phosphate(out).
  • GO:0035435 The process in which a phosphate is transported across a membrane.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

56 records
Show feature table
Start End DB Term Name
97 117 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
327 345 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
11 461 PIRSF PIRSF002808 Hexose_phosphate_transp
11 461 InterPro IPR000849 Sugar phosphate transporter
184 188 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
211 259 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
65 85 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
260 278 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
66 88 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
29 229 FunFam G3DSA:1.20.1250.20:FF:000031 Hexose phosphate transporter
423 446 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
189 210 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
351 380 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
124 146 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
325 347 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
357 379 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
447 463 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
123 148 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
159 181 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
156 172 ProSitePatterns PS00942 glpT family of transporters signature.
156 172 InterPro IPR021159 Glycerate/sugar phosphate transporter, conserved site
20 454 SUPERFAMILY SSF103473 MFS general substrate transporter
20 454 InterPro IPR036259 MFS transporter superfamily
381 391 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
298 318 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
9 456 PANTHER PTHR43826 GLUCOSE-6-PHOSPHATE EXCHANGER SLC37A4
392 411 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
36 426 NCBIfam TIGR00881 phosphoglycerate transporter protein PgtP
27 450 ProSiteProfiles PS50850 Major facilitator superfamily (MFS) profile.
27 450 InterPro IPR020846 Major facilitator superfamily domain
29 228 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
29 228 InterPro IPR036259 MFS transporter superfamily
160 183 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
86 96 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
149 159 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
412 422 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
28 46 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
319 326 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
35 397 Pfam PF07690 Major Facilitator Superfamily
35 397 InterPro IPR011701 Major facilitator superfamily
346 350 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
246 461 Gene3D G3DSA:1.20.1250.20 MFS general substrate transporter like domains
246 461 InterPro IPR036259 MFS transporter superfamily
1 27 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
28 45 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
28 444 CDD cd17345 MFS_GlpT
254 276 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
97 119 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
392 414 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
246 461 FunFam G3DSA:1.20.1250.20:FF:000033 Hexose phosphate transporter
279 297 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
424 446 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
118 122 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
296 318 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
191 210 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
46 64 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #17
0.762
Show in viewer
Surrounding area
Site 2 FPocket #11
0.39
Likely same site as P2Rank 2 1.4 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 3 FPocket #2
0.231
Show in viewer
Surrounding area

Binding pockets · P2Rank

Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Site 1 P2Rank #1
0.972
Show in viewer
Surrounding area
Site 2 P2Rank #2
0.132
Likely same site as FPocket 11 1.4 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Site 3 P2Rank #3
0.019
Show in viewer
Surrounding area
Site 4 P2Rank #4
0.001
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GXN0
AlphaFold DB full sequence Viewing
ColabFold KP13_00086
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 1 0 loaded crystals
Measured bioactivity 7 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
J0M PDB via homolog 196.2 Da · LogP -3.49 · TPSA 138.5 Open detail RCSB PDB
CHEMBL236247 ChEMBL via homolog · pchembl 8.70 (~2.0 nM) Detail ChEMBL
CHEMBL238371 ChEMBL via homolog · pchembl 8.30 (~5.0 nM) Detail ChEMBL
CHEMBL3218305 ChEMBL via homolog · pchembl 7.10 (~79.4 nM) Detail ChEMBL
CHEMBL3218306 ChEMBL via homolog · pchembl 6.89 (~128.8 nM) Detail ChEMBL

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
J0M RCSB PDB J7QAK3 196.2 Da LogP -3.49 TPSA 138.5 1 viol. ✓ Clean C([C@H]([C@@H]([C@@H]([C@H](C(=O)O)O)O)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.