KpKP13 Protein target profile
Drug resistance transporter, Bcr/CflA subfamily protein
Accession: KP13_00118
Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 0.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 91.12 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MARVSLSWALILGLLSGIGPLCTDFYLPALPEITQQLQATSTQTQLSLTAALIGLGLGQLFFGPLSDRIGRLKPLALSLLLFIFSSAMCALTRDINMLIIWRFLQGFAGAGGSVLSRSIARDKYQGTLLTQFFALLMTVNGIAPVLSPVLGGYVITAFDWRILFWTMAAIGGVLLVMSLAILRETRPATAAHASRQRPGQPVLKNRRFLRFCLIQAFMMAGLFSYIGSSSFVMQSEYGMSAMQFSLLFGLNGIGLIIAAMIFSRLARRFSAESLLRGGLTLAVSCAAIMLLFAWLHLPVLALVGLFFTVSLMSGISTVAGAEAMSAVNAAQSGTASALMGTLMFVFGGIAAPLAGLGGETMLKMSLAMAICYLLALLLGLSKPRDAR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- CytoplasmicMembrane
Gene Ontology (GO)
6- GO:0022857 Enables the transfer of a substance, usually a specific substance or a group of related substances, from one side of a membrane to the other.
- GO:1990961 A process that reduces or removes the toxicity of a xenobiotic by exporting it outside the cell.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0042910 Enables the directed movement of a xenobiotic from one side of a membrane to the other. A xenobiotic is a compound foreign to the organism exposed to it. It may be synthesized by another organism (like ampicilin) or it can be a synthetic chemical.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 16 | 20 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 99 | 120 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 322 | 332 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 1 | 20 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 333 | 355 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 64 | 74 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 133 | 155 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 157 | 161 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 263 | 273 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 1 | 3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 9 | 376 | PANTHER | PTHR23502 | MAJOR FACILITATOR SUPERFAMILY |
| 361 | 380 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 296 | 300 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 98 | 120 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 5 | 387 | ProSiteProfiles | PS50850 | Major facilitator superfamily (MFS) profile. |
| 5 | 387 | InterPro | IPR020846 | Major facilitator superfamily domain |
| 7 | 29 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 244 | 266 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 361 | 380 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 240 | 262 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 19 | 352 | Pfam | PF07690 | Major Facilitator Superfamily |
| 19 | 352 | InterPro | IPR011701 | Major facilitator superfamily |
| 44 | 63 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 207 | 229 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 21 | 43 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 132 | 156 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 9 | 371 | CDD | cd17320 | MFS_MdfA_MDR_like |
| 299 | 321 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 121 | 131 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 1 | 17 | SignalP_EUK | SignalP-TM | SignalP-TM |
| 381 | 387 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 356 | 360 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 7 | 377 | NCBIfam | TIGR00710 | Bcr/CflA family efflux MFS transporter |
| 7 | 377 | InterPro | IPR004812 | Drug resistance transporter Bcr/CmlA subfamily |
| 273 | 295 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 183 | 207 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 160 | 182 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 274 | 295 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 208 | 228 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 9 | 381 | Gene3D | G3DSA:1.20.1720.10 | Multidrug resistance protein D |
| 229 | 239 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 94 | 98 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 75 | 92 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 301 | 321 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 334 | 356 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 4 | 15 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 162 | 182 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 44 | 63 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 75 | 93 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 8 | 380 | SUPERFAMILY | SSF103473 | MFS general substrate transporter |
| 8 | 380 | InterPro | IPR036259 | MFS transporter superfamily |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3H4P4
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_00118
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CLM RCSB PDB | P0AEY8 | 323.1 Da LogP 0.91 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
c1cc(ccc1[C@H]([C@@H](CO)NC(=O)C(Cl)Cl)O)[N+](=…
|
|
| DXC RCSB PDB | P0AEY8 | 392.6 Da LogP 4.48 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@]1([C@H](C[C…
|
|
| KHJ RCSB PDB | P0AEY8 | 186.3 Da LogP 1.00 TPSA 7.8 | ✓ Ro5 | ✓ Clean |
C[n+]1ccc(cc1)c2cc[n+](cc2)C
|
|
| LDA RCSB PDB | P0AEY8 | 229.4 Da LogP 4.48 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[N+](C)(C)[O-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL333888 ChEMBL | P0AEY8 | 6.52 ~302.0 nM | 546.6 Da LogP 1.41 TPSA 181.6 | 2 viol. | ✓ Clean |
CC(C)CCSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C…
|
| CHEMBL339030 ChEMBL | P0AEY8 | 6.52 ~302.0 nM | 544.6 Da LogP 1.15 TPSA 181.6 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL122262 ChEMBL | P0AEY8 | 6.40 ~398.1 nM | 532.6 Da LogP 1.02 TPSA 181.6 | 2 viol. | ✓ Clean |
CC(C)CSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(…
|
| CHEMBL331492 ChEMBL | P0AEY8 | 6.40 ~398.1 nM | 528.6 Da LogP 2.18 TPSA 161.4 | 1 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL420159 ChEMBL | P0AEY8 | 6.30 ~501.2 nM | 532.6 Da LogP 1.01 TPSA 181.6 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL339999 ChEMBL | P0AEY8 | 6.22 ~602.6 nM | 558.7 Da LogP 1.54 TPSA 181.6 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL421456 ChEMBL | P0AEY8 | 6.22 ~602.6 nM | 553.0 Da LogP 0.84 TPSA 181.6 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL123933 ChEMBL | P0AEY8 | 6.16 ~691.8 nM | 518.6 Da LogP 0.77 TPSA 181.6 | 2 viol. | ✓ Clean |
CC(C)SC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(O…
|
| CHEMBL124794 ChEMBL | P0AEY8 | 6.16 ~691.8 nM | 582.6 Da LogP 0.42 TPSA 204.7 | 2 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(N)=O)=C(O)[C@@]2(O)C(=O)C3…
|
| CHEMBL125490 ChEMBL | P0AEY8 | 6.16 ~691.8 nM | 504.6 Da LogP 0.39 TPSA 181.6 | 2 viol. | ✓ Clean |
CCSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(O)=C…
|
| CHEMBL338009 ChEMBL | P0AEY8 | 6.16 ~691.8 nM | 518.6 Da LogP 0.78 TPSA 181.6 | 2 viol. | ✓ Clean |
CCCSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(O)=…
|
| CHEMBL122174 ChEMBL | P0AEY8 | 6.10 ~794.3 nM | 532.6 Da LogP 1.17 TPSA 181.6 | 2 viol. | ✓ Clean |
CCCCSC[C@H]1c2cccc(O)c2C(=O)C2=C(O)[C@]3(O)C(O)…
|
| CHEMBL334080 ChEMBL | P0AEY8 | 6.00 ~1.0 µM | 643.8 Da LogP 1.07 TPSA 180.1 | 3 viol. | ✓ Clean |
CN(C)[C@@H]1C(=O)C(C(=O)NCN2CCOCC2)=C(O)[C@@]2(…
|
| CHEMBL1304422 ChEMBL | P28873 | — | 514.5 Da LogP 4.37 TPSA 86.7 | 1 viol. | ✓ Clean |
O=C(c1ccc2c(c1)OCO2)N1CCC2(CC1)Oc1ccc(F)cc1C(=O…
|
| CHEMBL1304489 ChEMBL | P28873 | — | 390.2 Da LogP 3.19 TPSA 120.1 | ✓ Ro5 | ✓ Clean |
NC(=O)c1nc(-c2ccco2)nc2c1nc(O)n2-c1ccc(Cl)c(Cl)…
|
| CHEMBL1313324 ChEMBL | P28873 | — | 416.5 Da LogP 4.23 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CCN1C(=O)/C(=C/c2ccc(-c3nc4ccccc4s3)o2)SC…
|
| CHEMBL1331061 ChEMBL | P28873 | — | 458.8 Da LogP 5.86 TPSA 68.3 | 1 viol. | ✓ Clean |
O=C(COC(=O)c1c2ccccc2cc2ccccc12)Nc1ncc(C(F)(F)F…
|
| CHEMBL1349353 ChEMBL | P28873 | — | 470.9 Da LogP 4.63 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
CC(C)C(=O)N1CCC2(CC1)Oc1ccc(F)cc1C(=O)C21CC(c2c…
|
| CHEMBL1353438 ChEMBL | P28873 | — | 475.5 Da LogP 0.93 TPSA 131.1 | ✓ Ro5 | ✓ Clean |
Cc1ccc(S(=O)(=O)N2CCOCC2)cc1NC(=O)COC(=O)CNC(=O…
|
| CHEMBL1356936 ChEMBL | P28873 | — | 331.2 Da LogP 3.78 TPSA 56.2 | ✓ Ro5 | ✓ Clean |
Nc1c(Cl)cc(C2=NCCn3nc4ccccc4c32)cc1Cl
|
| CHEMBL1389504 ChEMBL | P28873 | — | 470.6 Da LogP 4.08 TPSA 84.3 | ✓ Ro5 | ✓ Clean |
Cc1cccc(C)c1-n1c(SCC(=O)N2CC(=O)Nc3ccccc32)nc2c…
|
| CHEMBL1394643 ChEMBL | P28873 | — | 475.5 Da LogP 4.72 TPSA 85.0 | ✓ Ro5 | ✓ Clean |
COc1ccc(C2CC(c3ccccc3C(F)(F)F)=NN2c2ccc(S(N)(=O…
|
| CHEMBL1412423 ChEMBL | P28873 | — | 387.4 Da LogP 3.12 TPSA 98.1 | ✓ Ro5 | Alert |
O=C(O)C(c1ccccc1)N1C(=O)/C(=C\c2ccc(O)c(O)c2)SC…
|
| CHEMBL1448425 ChEMBL | P28873 | — | 296.4 Da LogP 2.65 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
COCCn1c(=S)[nH]c2sc3c(c2c1=O)CCCC3
|
| CHEMBL1470884 ChEMBL | P28873 | — | 460.4 Da LogP 4.84 TPSA 67.8 | ✓ Ro5 | ✓ Clean |
CCO[C@@H]1OC(C(=O)Nc2ccccc2)=C[C@H](c2ccc(Br)cc…
|
| CHEMBL1500500 ChEMBL | P28873 | — | 528.9 Da LogP 3.53 TPSA 29.1 | 1 viol. | ✓ Clean |
O=C(C[n+]1cc(-c2ccc(Cl)c(Cl)c2)n2c1CCC2)N1c2ccc…
|
| CHEMBL1501053 ChEMBL | P28873 | — | 375.4 Da LogP 2.60 TPSA 116.2 | ✓ Ro5 | ✓ Clean |
COc1ccccc1-c1nc(C(N)=O)c2nc(O)n(-c3cccc(C)c3)c2…
|
| CHEMBL1518277 ChEMBL | P28873 | — | 436.5 Da LogP 3.98 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
CC(C)C(=O)N1CCC2(CC1)Oc1ccc(F)cc1C(=O)C21CC(c2c…
|
| CHEMBL1524956 ChEMBL | P28873 | — | 351.5 Da LogP 5.25 TPSA 22.8 | 1 viol. | ✓ Clean |
Cn1cc(C(c2ccccn2)c2cn(C)c3ccccc23)c2ccccc21
|
| CHEMBL1533676 ChEMBL | P28873 | — | 338.5 Da LogP 5.31 TPSA 35.0 | 1 viol. | ✓ Clean |
COc1ccc2nc(C)cc(Sc3nc4ccccc4s3)c2c1
|
| CHEMBL1541662 ChEMBL | P28873 | — | 523.9 Da LogP 4.90 TPSA 94.2 | 1 viol. | ✓ Clean |
Cc1noc(C)c1C(=O)N1CCC2(CC1)Oc1ccc(F)cc1C(=O)C21…
|
| CHEMBL1543082 ChEMBL | P28873 | — | 436.5 Da LogP 4.55 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc(C2CC(c3ccccc3)=NN2S(=O)(=O)c2ccc(C)cc2…
|
| CHEMBL1549687 ChEMBL | P28873 | — | 325.4 Da LogP 3.59 TPSA 62.9 | ✓ Ro5 | Alert |
O=C1/C(=C/c2ccco2)Oc2c1ccc(O)c2CN1CCCCC1
|
| CHEMBL1566010 ChEMBL | P28873 | — | 270.4 Da LogP 3.69 TPSA 49.8 | ✓ Ro5 | ✓ Clean |
Cc1ccc(-c2c(C#N)c(S)nc3c2CCCC3)o1
|
| CHEMBL1570427 ChEMBL | P28873 | — | 339.4 Da LogP 4.07 TPSA 47.9 | ✓ Ro5 | Alert |
COc1ccc(/C=C2\SC(c3ccc(C)cc3)=NC2=O)cc1OC
|
| CHEMBL1571603 ChEMBL | P28873 | — | 332.4 Da LogP 1.62 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
C#CC[N+](C)(C)CCCCCCCCCCCC.[Br-]
|
| CHEMBL1583627 ChEMBL | P28873 | — | 502.6 Da LogP 5.10 TPSA 68.2 | 2 viol. | ✓ Clean |
O=C(/C=C/c1cccs1)N1CCC2(CC1)Oc1ccc(F)cc1C(=O)C2…
|
| CHEMBL1586356 ChEMBL | P28873 | — | 316.3 Da LogP 2.59 TPSA 104.7 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCOC(=O)c2ccc(N)c([N+](=O)[O-])c2)cc1
|
| CHEMBL1701612 ChEMBL | P28873 | — | 503.7 Da LogP 7.13 TPSA 40.2 | 2 viol. | ✓ Clean |
COc1cc(OC)cc(-c2sc3ccc(OC)cc3c2-c2ccc(OCCN3CCCC…
|
| CHEMBL1706731 ChEMBL | P28873 | — | 431.5 Da LogP 2.67 TPSA 90.0 | ✓ Ro5 | ✓ Clean |
Cc1ccc(C)c(C(=O)COC(=O)c2ccc(C)c(S(=O)(=O)N3CCO…
|
| CHEMBL1706919 ChEMBL | P28873 | — | 505.6 Da LogP 5.97 TPSA 49.4 | 2 viol. | ✓ Clean |
COc1cc(OC)cc(-c2sc3ccc(OC)cc3c2-c2ccc(OCCN3CCOC…
|
| CHEMBL1710358 ChEMBL | P28873 | — | 459.6 Da LogP 6.73 TPSA 30.9 | 1 viol. | ✓ Clean |
COc1ccc2sc(-c3ccccc3OC)c(-c3ccc(OCCN4CCCC4)cc3)…
|
| CHEMBL1712927 ChEMBL | P28873 | — | 433.6 Da LogP 6.19 TPSA 30.9 | 1 viol. | ✓ Clean |
COc1ccc2sc(-c3ccccc3OC)c(-c3ccc(OCCN(C)C)cc3)c2…
|
| CHEMBL1713695 ChEMBL | P28873 | — | 443.6 Da LogP 7.11 TPSA 21.7 | 1 viol. | ✓ Clean |
COc1ccccc1-c1sc2ccccc2c1-c1ccc(OCCN2CCCCC2)cc1
|
| CHEMBL1719835 ChEMBL | P28873 | — | 475.6 Da LogP 5.96 TPSA 40.2 | 1 viol. | ✓ Clean |
COc1ccc2sc(-c3ccccc3OC)c(-c3ccc(OCCN4CCOCC4)cc3…
|
| CHEMBL1722206 ChEMBL | P28873 | — | 433.6 Da LogP 6.19 TPSA 30.9 | 1 viol. | ✓ Clean |
COc1cccc(-c2sc3ccc(OC)cc3c2-c2ccc(OCCN(C)C)cc2)…
|
| CHEMBL1724117 ChEMBL | P28873 | — | 602.8 Da LogP 3.69 TPSA 137.5 | 1 viol. | ✓ Clean |
COc1ccc(S(=O)(=O)N(C)C[C@H]2Oc3c(NC(=O)NC4CCCCC…
|
| CHEMBL1891367 ChEMBL | P28873 | — | 683.5 Da LogP 5.77 TPSA 101.9 | 2 viol. | ✓ Clean |
O=C(O)C(F)(F)F.O=C1C(Cc2ccccc2)Nc2ncnc(N3CCN(c4…
|
| CHEMBL2001294 ChEMBL | P28873 | — | 378.5 Da LogP 6.92 TPSA 16.1 | 1 viol. | Alert |
CCN(CC)c1ccc(/C=C/c2cc(-c3ccccc3)c3ccccc3n2)cc1
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC11852682 ZINC | 1.000 | 436.5 Da LogP 4.55 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc([C@@H]2CC(c3ccccc3)=NN2S(=O)(=O)c2ccc(…
|
| ZINC11852683 ZINC | 1.000 | 436.5 Da LogP 4.55 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc([C@H]2CC(c3ccccc3)=NN2S(=O)(=O)c2ccc(C…
|
| ZINC12493596 ZINC | 1.000 | 392.6 Da LogP 4.48 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@H]1CC[C@H]2[C@@H]3CC[C@H]4C[…
|
| ZINC13476679 ZINC | 1.000 | 339.4 Da LogP 4.07 TPSA 47.9 | ✓ Ro5 | Alert |
COc1ccc(/C=C2/SC(c3ccc(C)cc3)=NC2=O)cc1OC
|
| ZINC1849937 ZINC | 1.000 | 201.4 Da LogP 3.70 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2008702 ZINC | 1.000 | 243.4 Da LogP 4.87 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2039372 ZINC | 1.000 | 229.4 Da LogP 4.48 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC2040528018 ZINC | 1.000 | 416.5 Da LogP 4.23 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CCN1C(=O)C(=Cc2ccc(-c3nc4ccccc4s3)o2)SC1=S
|
| ZINC2295491526 ZINC | 1.000 | 339.4 Da LogP 4.07 TPSA 47.9 | ✓ Ro5 | Alert |
COc1ccc(C=C2SC(c3ccc(C)cc3)=NC2=O)cc1OC
|
| ZINC2355120 ZINC | 1.000 | 339.4 Da LogP 3.98 TPSA 62.9 | ✓ Ro5 | Alert |
O=C1/C(=C/c2ccco2)Oc2c1ccc(O)c2CN1CCCCCC1
|
| ZINC2434684 ZINC | 1.000 | 416.5 Da LogP 4.23 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CCN1C(=O)/C(=C\c2ccc(-c3nc4ccccc4s3)o2)SC…
|
| ZINC2434685 ZINC | 1.000 | 416.5 Da LogP 4.23 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CCN1C(=O)/C(=C/c2ccc(-c3nc4ccccc4s3)o2)SC…
|
| ZINC2445091 ZINC | 1.000 | 325.4 Da LogP 3.59 TPSA 62.9 | ✓ Ro5 | Alert |
O=C1/C(=C/c2ccco2)Oc2c1ccc(O)c2CN1CCCCC1
|
| ZINC2516963 ZINC | 1.000 | 215.4 Da LogP 4.09 TPSA 23.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCC[N+](C)(C)[O-]
|
| ZINC257235 ZINC | 1.000 | 339.4 Da LogP 4.07 TPSA 47.9 | ✓ Ro5 | Alert |
COc1ccc(/C=C2\SC(c3ccc(C)cc3)=NC2=O)cc1OC
|
| ZINC257356883 ZINC | 1.000 | 392.6 Da LogP 4.48 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3CC[C@H]4…
|
| ZINC257356885 ZINC | 1.000 | 392.6 Da LogP 4.48 TPSA 77.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CCC(=O)O)[C@@H]1CC[C@@H]2[C@@H]3CC[C@H]4…
|
| ZINC2644713 ZINC | 1.000 | 470.6 Da LogP 4.08 TPSA 84.3 | ✓ Ro5 | ✓ Clean |
Cc1cccc(C)c1-n1c(SCC(=O)N2CC(=O)Nc3ccccc32)nc2c…
|
| ZINC5351683 ZINC | 1.000 | 387.4 Da LogP 3.12 TPSA 98.1 | ✓ Ro5 | Alert |
O=C(O)[C@H](c1ccccc1)N1C(=O)/C(=C\c2ccc(O)c(O)c…
|
| ZINC5351688 ZINC | 1.000 | 387.4 Da LogP 3.12 TPSA 98.1 | ✓ Ro5 | Alert |
O=C(O)[C@@H](c1ccccc1)N1C(=O)/C(=C\c2ccc(O)c(O)…
|
| ZINC6016610 ZINC | 1.000 | 296.4 Da LogP 2.65 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
COCCn1c(=S)[nH]c2sc3c(c2c1=O)CCCC3
|
| ZINC7122480 ZINC | 1.000 | 316.3 Da LogP 2.59 TPSA 104.7 | ✓ Ro5 | ✓ Clean |
COc1ccc(CCOC(=O)c2ccc(N)c([N+](=O)[O-])c2)cc1
|
| ZINC8693825 ZINC | 1.000 | 475.5 Da LogP 0.93 TPSA 131.1 | ✓ Ro5 | ✓ Clean |
Cc1ccc(S(=O)(=O)N2CCOCC2)cc1NC(=O)COC(=O)CNC(=O…
|
| ZINC9632267 ZINC | 1.000 | 431.5 Da LogP 2.67 TPSA 90.0 | ✓ Ro5 | ✓ Clean |
Cc1ccc(C)c(C(=O)COC(=O)c2ccc(C)c(S(=O)(=O)N3CCO…
|
| ZINC2438269 ZINC | 0.979 | 311.3 Da LogP 3.20 TPSA 62.9 | ✓ Ro5 | Alert |
O=C1/C(=C/c2ccco2)Oc2c1ccc(O)c2CN1CCCC1
|
| ZINC1809789 ZINC | 0.957 | 210.4 Da LogP 3.45 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
C#CC[N+](C)(C)CCCCCCCCC
|
| ZINC1835275 ZINC | 0.957 | 252.5 Da LogP 4.62 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
C#CC[N+](C)(C)CCCCCCCCCCCC
|
| ZINC2274039 ZINC | 0.957 | 224.4 Da LogP 3.84 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
C#CC[N+](C)(C)CCCCCCCCCC
|
| ZINC11852684 ZINC | 0.940 | 450.6 Da LogP 4.86 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc([C@@H]2CC(c3ccc(C)cc3)=NN2S(=O)(=O)c2c…
|
| ZINC11852685 ZINC | 0.940 | 450.6 Da LogP 4.86 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc([C@H]2CC(c3ccc(C)cc3)=NN2S(=O)(=O)c2cc…
|
| ZINC1077173 ZINC | 0.900 | 422.5 Da LogP 4.24 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc([C@H]2CC(c3ccccc3)=NN2S(=O)(=O)c2ccccc…
|
| ZINC1077174 ZINC | 0.900 | 422.5 Da LogP 4.24 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc([C@@H]2CC(c3ccccc3)=NN2S(=O)(=O)c2cccc…
|
| ZINC2040447814 ZINC | 0.897 | 430.5 Da LogP 4.62 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CCCN1C(=O)C(=Cc2ccc(-c3nc4ccccc4s3)o2)SC1…
|
| ZINC2415873 ZINC | 0.897 | 430.5 Da LogP 4.62 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CCCN1C(=O)/C(=C\c2ccc(-c3nc4ccccc4s3)o2)S…
|
| ZINC2415874 ZINC | 0.897 | 430.5 Da LogP 4.62 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CCCN1C(=O)/C(=C/c2ccc(-c3nc4ccccc4s3)o2)S…
|
| ZINC2411938 ZINC | 0.877 | 402.5 Da LogP 3.84 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CN1C(=O)/C(=C\c2ccc(-c3nc4ccccc4s3)o2)SC1…
|
| ZINC2411939 ZINC | 0.877 | 402.5 Da LogP 3.84 TPSA 83.6 | ✓ Ro5 | Alert |
O=C(O)CN1C(=O)/C(=C/c2ccc(-c3nc4ccccc4s3)o2)SC1…
|
| ZINC9704233 ZINC | 0.873 | 435.5 Da LogP 2.50 TPSA 90.0 | ✓ Ro5 | ✓ Clean |
Cc1ccc(C)c(C(=O)COC(=O)c2ccc(F)c(S(=O)(=O)N3CCO…
|
| ZINC13004671 ZINC | 0.871 | 489.6 Da LogP 1.24 TPSA 131.1 | ✓ Ro5 | ✓ Clean |
Cc1ccc(C(=O)NCC(=O)OCC(=O)Nc2cc(S(=O)(=O)N3CCOC…
|
| ZINC6497781 ZINC | 0.870 | 310.4 Da LogP 3.04 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
COCCCn1c(=S)[nH]c2sc3c(c2c1=O)CCCC3
|
| ZINC9466106 ZINC | 0.859 | 489.6 Da LogP 1.24 TPSA 131.1 | ✓ Ro5 | ✓ Clean |
Cc1cccc(C(=O)NCC(=O)OCC(=O)Nc2cc(S(=O)(=O)N3CCO…
|
| ZINC3437431 ZINC | 0.852 | 470.6 Da LogP 4.08 TPSA 84.3 | ✓ Ro5 | ✓ Clean |
Cc1cccc(-n2c(SCC(=O)N3CC(=O)Nc4ccccc43)nc3ccccc…
|
| ZINC15016641 ZINC | 0.837 | 325.4 Da LogP 3.76 TPSA 47.9 | ✓ Ro5 | Alert |
COc1ccc(/C=C2\SC(c3ccccc3)=NC2=O)cc1OC
|
| ZINC483137 ZINC | 0.837 | 323.4 Da LogP 4.37 TPSA 38.7 | ✓ Ro5 | Alert |
COc1ccc(/C=C2\SC(c3ccc(C)cc3)=NC2=O)cc1C
|
| ZINC95116687 ZINC | 0.836 | 436.5 Da LogP 4.55 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc([C@@H]2CC(c3cccc(C)c3)=NN2S(=O)(=O)c2c…
|
| ZINC95116688 ZINC | 0.836 | 436.5 Da LogP 4.55 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
COc1cccc([C@H]2CC(c3cccc(C)c3)=NN2S(=O)(=O)c2cc…
|
| ZINC2218948 ZINC | 0.830 | 327.3 Da LogP 2.43 TPSA 72.1 | ✓ Ro5 | Alert |
O=C1/C(=C/c2ccco2)Oc2c1ccc(O)c2CN1CCOCC1
|
| ZINC6497780 ZINC | 0.830 | 296.4 Da LogP 2.65 TPSA 47.0 | ✓ Ro5 | ✓ Clean |
COCCCn1c(=S)[nH]c2sc3c(c2c1=O)CCC3
|
| ZINC710113 ZINC | 0.827 | 406.5 Da LogP 4.54 TPSA 59.0 | ✓ Ro5 | ✓ Clean |
COc1ccccc1[C@H]1CC(c2ccc(C)cc2)=NN1S(=O)(=O)c1c…
|
| ZINC710114 ZINC | 0.827 | 406.5 Da LogP 4.54 TPSA 59.0 | ✓ Ro5 | ✓ Clean |
COc1ccccc1[C@@H]1CC(c2ccc(C)cc2)=NN1S(=O)(=O)c1…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.