KpKP13 Protein target profile

putative inner membrane protein

Accession: KP13_00168

Gene: AHE42088.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GXF0
Length 205
Pocket druggability (P2Rank · AlphaFold DB model) 0.787
Direct ligand evidence 0 52 total records
Functional annotation 0 EC 1 GO
Target summary

Strong target candidate with converging metabolic, structural and chemical evidence.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
4.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
93.28 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.787
Structure A0A0H3GXF0
Pocket Pocket 1
Druggability (FPocket) 0.834
Structure A0A0H3GXF0
Pocket Pocket 1
ColabFold model
P2Rank 0.765 · Pocket 1
FPocket 0.691 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 195 / 4744 genomes with a hit
Prevalence 4.1%

Sequence

Primary amino-acid sequence viewer.

MLLHVLYLIGITAEAMTGALAAGRRRMDTFGVIIIATATALGGGSVRDILLGHYPLGWVKHPEYVIIVAVAAVLTTIAAPVMPHLRRLFLVLDALGLIVFSIIGAQIALDMGEGPVIASIAAVITGVFGGVLRDMFCKRIPLVFQKELYAGISFAAAVLYIALQHYVSSHDVVVLATLLFGFTARMLALRWKLGLPVFHYTHDAH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

1
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

27 records
Show feature table
Start End DB Term Name
114 136 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
64 81 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
115 136 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
5 22 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
137 147 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
88 109 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
172 189 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
29 51 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
5 78 Pfam PF03458 Glycine transporter
5 78 InterPro IPR005115 Glycine transporter
91 164 Pfam PF03458 Glycine transporter
91 164 InterPro IPR005115 Glycine transporter
24 29 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
148 166 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
6 23 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
30 52 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
172 189 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
148 167 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 203 PANTHER PTHR30506 INNER MEMBRANE PROTEIN
110 114 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
167 171 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
82 87 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
88 109 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
64 81 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
190 205 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
53 63 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.787
Likely same site as FPocket 1 1.0 Å 20 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.036
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.006
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.834 Unusual size
Likely same site as P2Rank 1 1.0 Å 20 shared residues 100% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GXF0
AlphaFold DB full sequence Viewing
ColabFold KP13_00168
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
PX4 PDB via homolog 679.0 Da · LogP 9.68 · TPSA 108.4 Open detail RCSB PDB
TGL PDB via homolog Detail RCSB PDB
ZINC13544781 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC13544783 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC13543439 ZINC proposed compound · Tanimoto 0.977 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
PX4 RCSB PDB Q3HKN0 679.0 Da LogP 9.68 TPSA 108.4 2 viol. ✓ Clean CCCCCCCCCCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCC[N+](…
TGL RCSB PDB Q981D4 891.5 Da LogP 18.77 TPSA 78.9 2 viol. ✓ Clean CCCCCCCCCCCCCCCCCC(=O)OCC(COC(=O)CCCCCCCCCCCCCC…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.