KpKP13 Protein target profile

Glutaredoxin-3

Accession: KP13_00211

Gene: AHE42124.1 grxC 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GYR4
Length 83
Pocket druggability (FPocket · AlphaFold DB model) 0.195
Direct ligand evidence 0 53 total records
Functional annotation 0 EC 5 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
34.118 Lower values reduce human off-target concern.
Human E-value
3.47e-10
Gut microbiome similarity
2.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
50.0 Higher values support similarity to known essential genes.
DEG E-value
2.22e-25 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
93.51 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank)
Structure A0A0H3GYR4
Pocket No pockets
Druggability (FPocket) 0.195
Structure A0A0H3GYR4
Pocket Pocket 2
ColabFold model
FPocket 0.154 · Pocket 2
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 131 / 4744 genomes with a hit
Prevalence 2.8%

Sequence

Primary amino-acid sequence viewer.

MANIEIYTKATCPFCIRAKALLNSKGVTFHELPIDGDAAKREEMIQRSGRTTVPQIFIDAQHIGGCDDLYALDSRGGLDPLLR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Subcellular localization

Localization
Unknown

Gene Ontology (GO)

5
  • GO:0045454 Any process that maintains the redox environment of a cell or compartment within a cell.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0015038 Catalysis of the reaction: 2 glutathione + electron acceptor = glutathione disulfide + electron donor.
  • GO:0034599 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
  • GO:0009263 The chemical reactions and pathways resulting in the formation of a deoxyribonucleotide, a compound consisting of deoxyribonucleoside (a base linked to a deoxyribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
1 83 Gene3D G3DSA:3.40.30.10 Glutaredoxin
6 22 ProSitePatterns PS00195 Glutaredoxin active site.
6 22 InterPro IPR011767 Glutaredoxin active site
4 63 Pfam PF00462 Glutaredoxin
4 63 InterPro IPR002109 Glutaredoxin
1 83 FunFam G3DSA:3.40.30.10:FF:000018 Glutaredoxin
4 82 NCBIfam TIGR02181 glutaredoxin 3
4 82 InterPro IPR011900 Glutaredoxin, GrxC
3 82 PANTHER PTHR45694 GLUTAREDOXIN 2
3 76 CDD cd03418 GRX_GRXb_1_3_like
3 76 InterPro IPR011900 Glutaredoxin, GrxC
1 83 ProSiteProfiles PS51354 Glutaredoxin domain profile.
4 22 PRINTS PR00160 Glutaredoxin signature
4 22 InterPro IPR014025 Glutaredoxin subgroup
46 59 PRINTS PR00160 Glutaredoxin signature
46 59 InterPro IPR014025 Glutaredoxin subgroup
60 73 PRINTS PR00160 Glutaredoxin signature
60 73 InterPro IPR014025 Glutaredoxin subgroup
1 83 SUPERFAMILY SSF52833 Thioredoxin-like
1 83 InterPro IPR036249 Thioredoxin-like superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

No pockets are loaded yet for the displayed AlphaFold DB model AF_A0A0H3GYR4 structure. Run experimental pocket backfill to show FPocket/P2Rank overlays on this structure.

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GYR4
AlphaFold DB full sequence Viewing
ColabFold KP13_00211
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

53 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 3 records from similar proteins
Structural ligands 3 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
CAC PDB via homolog 137.0 Da · LogP -0.52 · TPSA 40.1 Open detail RCSB PDB
GDS PDB via homolog Detail RCSB PDB
GSH PDB via homolog Detail RCSB PDB
ZINC3830891 ZINC proposed compound · Tanimoto 1.000 Detail ZINC
ZINC3830892 ZINC proposed compound · Tanimoto 1.000 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
CAC RCSB PDB Q5NHD0 137.0 Da LogP -0.52 TPSA 40.1 ✓ Ro5 ✓ Clean C[As](=O)(C)[O-]
GDS RCSB PDB A8MJH2 612.6 Da LogP -3.88 TPSA 317.6 3 viol. ✓ Clean C(CC(=O)N[C@@H](CSSC[C@@H](C(=O)NCC(=O)O)NC(=O)…
GSH RCSB PDB A0A1W6I4R7 307.3 Da LogP -2.21 TPSA 158.8 1 viol. ✓ Clean C(CC(=O)N[C@@H](CS)C(=O)NCC(=O)O)[C@@H](C(=O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.