KpKP13 Protein target profile

Xylulose kinase

Accession: KP13_00241

Gene: AHE42153.1 xylB 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GUN4
Length 484
Pocket druggability (P2Rank · AlphaFold DB model) 0.832
Direct ligand evidence 0 59 total records
Functional annotation 1 EC 8 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
31.405 Lower values reduce human off-target concern.
Human E-value
5.41e-07
Gut microbiome similarity
2.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.19 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.832
Structure A0A0H3GUN4
Pocket Pocket 1
Druggability (FPocket) 0.549
Structure A0A0H3GUN4
Pocket Pocket 7
ColabFold model
P2Rank 0.822 · Pocket 1
FPocket 0.7 · Pocket 13
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 101 / 4744 genomes with a hit
Prevalence 2.1%

Sequence

Primary amino-acid sequence viewer.

MYIGIDLGTSGVKAILLNEQGEVVASHTEKLTVSRPHPLWSEQDPEQWWLATDTAMKALGAQHSLRDVKALGIAGQMHGATLLDKSLQVLRPAILWNDGRCAEECQLLEDKVSASRQITGNLMMPGFTAPKLLWVQRHEAAVFSQVDKVLLPKDYLRLRMTGELASDMSDAAGTMWLDVARRDWSDEMLAACDLSRDAMPALFEGSDVTGQLRPEVAQAWNMPPALVVGGGGDNAAGAVGVGMADAGQAMLSLGTSGVYFAVSEGFLSKPESAVHSFCHALPGRWHLMSVMLSAASCLDWAAKLTGLASVPALIAAAQTADESAGPVWFLPYLSGERTPHNNPQAKGVFFGLTHQHGPAELARAVLEGVGYALADGMDVVHACGIKPQSITLIGGGARSAYWRQMLADISGLQLDYRTGGDVGPALGAARLAQLAVHDEADRPGLLKPLPLEQAHRPDDRRVAHYAPQRETFRQIYQQLKPLMS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 8 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

8
  • GO:0016773 Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to an alcohol group (acceptor).
  • GO:0005975 The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y.
  • GO:0016301 Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
  • GO:0004856 Catalysis of the reaction: D-xylulose + ATP = D-xylulose 5-phosphate + ADP + H+.
  • GO:0005997 The chemical reactions and pathways involving xylulose, the ketopentose threo-2-pentulose.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0042732 The chemical reactions and pathways involving D-xylose, a naturally occurring plant polysaccharide.
  • GO:0005998 The chemical reactions and pathways resulting in the breakdown of xylulose, the ketopentose threo-2-pentulose.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
1 240 Gene3D G3DSA:3.30.420.40 -
1 477 CDD cd07808 FGGY_D-XK_EcXK-like
1 484 PIRSF PIRSF000538 GlpK
1 484 InterPro IPR000577 Carbohydrate kinase, FGGY
126 138 ProSitePatterns PS00933 FGGY family of carbohydrate kinases signature 1.
126 138 InterPro IPR018483 Carbohydrate kinase, FGGY, conserved site
249 435 Pfam PF02782 FGGY family of carbohydrate kinases, C-terminal domain
249 435 InterPro IPR018485 Carbohydrate kinase, FGGY, C-terminal
1 480 Hamap MF_02220 Xylulose kinase [xylB].
1 480 InterPro IPR006000 Xylulokinase
2 483 PANTHER PTHR43095 SUGAR KINASE
3 477 NCBIfam TIGR01312 xylulokinase
3 477 InterPro IPR006000 Xylulokinase
242 484 Gene3D G3DSA:3.30.420.40 -
1 240 Pfam PF00370 FGGY family of carbohydrate kinases, N-terminal domain
1 240 InterPro IPR018484 Carbohydrate kinase, FGGY, N-terminal
243 483 SUPERFAMILY SSF53067 Actin-like ATPase domain
243 483 InterPro IPR043129 ATPase, nucleotide binding domain
2 242 SUPERFAMILY SSF53067 Actin-like ATPase domain
2 242 InterPro IPR043129 ATPase, nucleotide binding domain
347 367 ProSitePatterns PS00445 FGGY family of carbohydrate kinases signature 2.
347 367 InterPro IPR018483 Carbohydrate kinase, FGGY, conserved site

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.832
Likely same site as FPocket 17 7.7 Å 9 shared residues 60% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.463
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.278
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.078
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.042
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #7
0.549
Show in viewer
Surrounding area
Pocket 2 FPocket #17
0.445
Likely same site as P2Rank 1 7.7 Å 9 shared residues 60% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:233-233 Proton acceptor
UniProt: Binding site:77-78
UniProt: Site:6-6 Important for activity
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GUN4
AlphaFold DB full sequence Viewing
ColabFold KP13_00241
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 9 records from similar proteins
Structural ligands 9 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
ACP PDB via homolog 505.2 Da · LogP -1.52 · TPSA 269.9 Open detail RCSB PDB
ANP PDB via homolog Detail RCSB PDB
ATF PDB via homolog Detail RCSB PDB
ATS PDB via homolog Detail RCSB PDB
DXP PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ACP RCSB PDB P0A6F3 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ANP RCSB PDB O93623 506.2 Da LogP -2.06 TPSA 281.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ATF RCSB PDB P0A6F3 541.2 Da LogP -0.93 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ATS RCSB PDB P0A6F3 549.2 Da LogP -2.76 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
DXP RCSB PDB Q5FM28 214.1 Da LogP -1.59 TPSA 124.3 ✓ Ro5 ✓ Clean CC(=O)[C@H]([C@@H](COP(=O)(O)O)O)O
G3H RCSB PDB P0A6F3 170.1 Da LogP -1.34 TPSA 104.1 ✓ Ro5 ✓ Clean C([C@H](C=O)O)OP(=O)(O)O
MLI RCSB PDB Q7NWW7 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
NH4 RCSB PDB P09099 18.0 Da LogP 0.38 TPSA 36.5 ✓ Ro5 ✓ Clean [NH4+]
XUL RCSB PDB P09099 150.1 Da LogP -2.74 TPSA 98.0 ✓ Ro5 ✓ Clean C([C@H]([C@@H](C(=O)CO)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.