Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 94.72 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLSYRHSFHAGNHADVLKHTVQSLIIESLKEKEKPFLYLDTHAGAGRYQLSGEHAERTGEYLEGIARIWQQDDLPAELEPYISVVEHFNRNGQLRYYPGSPLIARQLLREQDSLQMTELHPSDFPLLRAEFQKDSRARVDKADGYQQLKAKLPPVSRRGLILIDPPYEIKTDYQAVVTGINEGYKRFATGTYALWYPVVLRAQIKRMIKELEATGIRKILQIELAVRPDSDQRGMTASGMIVINPPWKLEQQMNNVLPWLHSKLVPTGTGHATVSWIVPE
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
8- GO:0070475 The addition of a methyl group to an atom in the nucleoside base portion of a nucleotide residue in an rRNA molecule.
- GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
- GO:0003676 Binding to a nucleic acid.
- GO:0032259 The process in which a methyl group is covalently attached to a molecule.
- GO:0008649 Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a nucleoside residue in an rRNA molecule. The methyl group can be transfered to the nucleobase or to the ribose group of the nucleoside.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0036307 Catalysis of the reaction: S-adenosyl-L-methionine + adenine(2030) in 23S rRNA = S-adenosyl-L-homocysteine + rRNA containing N(6)-methyladenine(2030) in 23S rRNA.
- GO:0003723 Binding to an RNA molecule or a portion thereof.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 266 | Hamap | MF_00934 | Ribosomal RNA large subunit methyltransferase J [rlmJ]. |
| 2 | 266 | InterPro | IPR007473 | Ribosomal RNA large subunit methyltransferase J |
| 1 | 280 | FunFam | G3DSA:3.40.50.150:FF:000037 | Ribosomal RNA large subunit methyltransferase J |
| 1 | 280 | Gene3D | G3DSA:3.40.50.150 | Vaccinia Virus protein VP39 |
| 1 | 280 | InterPro | IPR029063 | S-adenosyl-L-methionine-dependent methyltransferase superfamily |
| 9 | 279 | SUPERFAMILY | SSF53335 | S-adenosyl-L-methionine-dependent methyltransferases |
| 9 | 279 | InterPro | IPR029063 | S-adenosyl-L-methionine-dependent methyltransferase superfamily |
| 241 | 247 | ProSitePatterns | PS00092 | N-6 Adenine-specific DNA methylases signature. |
| 241 | 247 | InterPro | IPR002052 | DNA methylase, N-6 adenine-specific, conserved site |
| 33 | 278 | Pfam | PF04378 | Ribosomal RNA large subunit methyltransferase D, RlmJ |
| 33 | 278 | InterPro | IPR007473 | Ribosomal RNA large subunit methyltransferase J |
| 1 | 280 | PANTHER | PTHR37426 | RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE J |
| 1 | 280 | InterPro | IPR007473 | Ribosomal RNA large subunit methyltransferase J |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GX18
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_00306
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| HY8 RCSB PDB | P37634 | 674.7 Da LogP -3.61 TPSA 311.4 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@@H](O3…
|
|
| HZ2 RCSB PDB | P37634 | 660.6 Da LogP -4.00 TPSA 311.4 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC584905214 ZINC | 0.726 | 452.5 Da LogP -1.92 TPSA 189.1 | 1 viol. | ✓ Clean |
CN(C)CCCN(CC[C@H](N)C(=O)O)C[C@H]1O[C@@H](n2cnc…
|
| ZINC11582480 ZINC | 0.597 | 339.3 Da LogP -1.68 TPSA 162.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O…
|
| ZINC12656099 ZINC | 0.597 | 339.3 Da LogP -1.68 TPSA 162.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O…
|
| ZINC1782261 ZINC | 0.597 | 339.3 Da LogP -1.68 TPSA 162.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)…
|
| ZINC247417127 ZINC | 0.597 | 339.3 Da LogP -1.68 TPSA 162.8 | ✓ Ro5 | ✓ Clean |
O=C(O)CCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)…
|
| ZINC105064588 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@H]…
|
| ZINC14451064 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O)[C@@…
|
| ZINC1685071 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@@…
|
| ZINC27414326 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](O)[C@@H…
|
| ZINC27414327 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@@H…
|
| ZINC4722772 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@H…
|
| ZINC4722773 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@…
|
| ZINC4722774 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@…
|
| ZINC6119248 ZINC | 0.594 | 311.3 Da LogP -2.16 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
OCCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O)[C@H…
|
| ZINC1319874 ZINC | 0.581 | 353.4 Da LogP -1.13 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
C[C@H](CO)CCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@…
|
| ZINC13782061 ZINC | 0.581 | 353.4 Da LogP -1.13 TPSA 145.8 | ✓ Ro5 | ✓ Clean |
C[C@@H](CO)CCNc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@…
|
| ZINC13650200 ZINC | 0.568 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@H](N)…
|
| ZINC205994753 ZINC | 0.568 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@H](N)…
|
| ZINC205994774 ZINC | 0.568 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@H](N)…
|
| ZINC27723577 ZINC | 0.568 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@H](N)…
|
| ZINC38192471 ZINC | 0.568 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@H](N)CC[C@@H](N…
|
| ZINC38192472 ZINC | 0.568 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@@H](N)CC[C@@H](…
|
| ZINC4217451 ZINC | 0.568 | 381.4 Da LogP -2.06 TPSA 208.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[C@@H](N)CC[C@H](N…
|
| ZINC2047403 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@@H]1O
|
| ZINC2047673 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@H](O)[C@@H]1O
|
| ZINC2169830 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O
|
| ZINC3201876 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO)[C@@H](O)[C@@H]1O
|
| ZINC3201878 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H]…
|
| ZINC3830178 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@H]1O
|
| ZINC3830179 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@H]1O
|
| ZINC3978047 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O
|
| ZINC3978048 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO)[C@H](O)[C@H]1O
|
| ZINC3978049 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@H]1O
|
| ZINC4048240 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO)[C@@H](O)[C@H]1O
|
| ZINC8580514 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@@H]1O
|
| ZINC895113 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O
|
| ZINC896706 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](O)[C@H]1O
|
| ZINC970363 ZINC | 0.567 | 267.2 Da LogP -1.98 TPSA 139.5 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O
|
| ZINC13522400 ZINC | 0.560 | 400.4 Da LogP -2.42 TPSA 199.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[S@](=O)CC[C@H](N)…
|
| ZINC13522403 ZINC | 0.560 | 400.4 Da LogP -2.42 TPSA 199.7 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](C[S@@](=O)CC[C@H](N…
|
| ZINC4188096 ZINC | 0.559 | 297.3 Da LogP -2.62 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@@H](…
|
| ZINC4188103 ZINC | 0.559 | 297.3 Da LogP -2.62 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H]…
|
| ZINC4188112 ZINC | 0.559 | 297.3 Da LogP -2.62 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@@H](…
|
| ZINC4188116 ZINC | 0.559 | 297.3 Da LogP -2.62 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C@@H]…
|
| ZINC12501055 ZINC | 0.553 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC13509082 ZINC | 0.553 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CSCC[C@@H](N)C(=O)O…
|
| ZINC33821012 ZINC | 0.553 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC33821013 ZINC | 0.553 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC4228232 ZINC | 0.553 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CSCC[C@H](N)C(=O)O)…
|
| ZINC45789230 ZINC | 0.553 | 384.4 Da LogP -1.44 TPSA 182.6 | 1 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CSCC[C@H](N)C(=O)O…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.