KpKP13 Protein target profile

Aspartate-semialdehyde dehydrogenase

Accession: KP13_00662

Gene: asd AHE42281.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3H447
Length 368
Pocket druggability (P2Rank · AlphaFold DB model) 0.744
Direct ligand evidence 0 58 total records
Functional annotation 0 EC 11 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
5.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
94.565 Higher values support similarity to known essential genes.
DEG E-value
0.0 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
97.72 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.744
Structure A0A0H3H447
Pocket Pocket 1
Druggability (FPocket) 0.538
Structure A0A0H3H447
Pocket Pocket 1
ColabFold model
P2Rank 0.753 · Pocket 1
FPocket 0.531 · Pocket 1
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 243 / 4744 genomes with a hit
Prevalence 5.1%

Sequence

Primary amino-acid sequence viewer.

MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQPAPSFGGSTGGTLQDAFDLDALKALDIIVTCQGGDYTNEIYPKLRASGWQGYWIDAASSLRMKDDAIIILDPVNQDVITAGLNNGVKTFVGGNCTVSLMLMSLGGLFAQDLVEWVSVATYQAASGGGARHMRELLSQMGQLHNHVAAELADPASAILDIERKVTSLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKILATSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEYLSAFTVGDQLLWGAAEPLRRMLRQLA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

11 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

11
  • GO:0009089 OBSOLETE. The chemical reactions and pathways resulting in the formation of lysine, via the intermediate diaminopimelate.
  • GO:0009086 OBSOLETE. The chemical reactions and pathways resulting in the de novo formation of L-methionine (2-amino-4-(methylthio)butanoic acid), a sulfur-containing, essential amino acid found in peptide linkage in proteins.
  • GO:0009097 OBSOLETE. The chemical reactions and pathways resulting in the formation of isoleucine, (2R*,3R*)-2-amino-3-methylpentanoic acid.
  • GO:0009088 The chemical reactions and pathways resulting in the formation of L-threonine (2-amino-3-hydroxybutyric acid), a polar, uncharged, essential amino acid found in peptide linkage in proteins.
  • GO:0006520 The chemical reactions and pathways involving amino acids, carboxylic acids containing one or more amino groups.
  • GO:0004073 Catalysis of the reaction: L-aspartate 4-semialdehyde + NADP+ + phosphate = 4-phospho-L-aspartate + H+ + NADPH.
  • GO:0051287 Binding to nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
  • GO:0016620 Catalysis of an oxidation-reduction (redox) reaction in which an aldehyde or ketone (oxo) group acts as a hydrogen or electron donor and reduces NAD or NADP.
  • GO:0046983 The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
  • GO:0050661 Binding to nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
  • GO:0008652 The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
1 368 PIRSF PIRSF000148 ASA_dh
135 355 SUPERFAMILY SSF55347 Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
4 357 Gene3D G3DSA:3.40.50.720 -
1 368 Hamap MF_02121 Aspartate-semialdehyde dehydrogenase [asd].
1 368 InterPro IPR012080 Aspartate-semialdehyde dehydrogenase
262 276 ProSitePatterns PS01103 Aspartate-semialdehyde dehydrogenase signature.
262 276 InterPro IPR000319 Aspartate-semialdehyde dehydrogenase, conserved site
4 140 FunFam G3DSA:3.40.50.720:FF:000152 Aspartate-semialdehyde dehydrogenase
145 354 Pfam PF02774 Semialdehyde dehydrogenase, dimerisation domain
145 354 InterPro IPR012280 Semialdehyde dehydrogenase, dimerisation domain
137 352 Gene3D G3DSA:3.30.360.10 Dihydrodipicolinate Reductase; domain 2
3 123 SMART SM00859 Semialdhyde_dh_3
3 123 InterPro IPR000534 Semialdehyde dehydrogenase, NAD-binding
3 121 Pfam PF01118 Semialdehyde dehydrogenase, NAD binding domain
3 121 InterPro IPR000534 Semialdehyde dehydrogenase, NAD-binding
2 367 PANTHER PTHR46278 DEHYDROGENASE, PUTATIVE-RELATED
2 367 NCBIfam TIGR01745 aspartate-semialdehyde dehydrogenase
2 367 InterPro IPR011534 Aspartate-semialdehyde dehydrogenase, gamma-type
137 352 FunFam G3DSA:3.30.360.10:FF:000012 Aspartate-semialdehyde dehydrogenase
1 148 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
1 148 InterPro IPR036291 NAD(P)-binding domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.744
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.055
Likely same site as FPocket 1 1.2 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.026
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.538
Likely same site as P2Rank 2 1.2 Å 10 shared residues 100% of smaller site
Show in viewer
Surrounding area
Residue sets
UniProt: Active site:136-136 Acyl-thioester intermediate
UniProt: Active site:275-275 Proton acceptor
UniProt: Binding site:10-13
UniProt: Binding site:103-103
UniProt: Binding site:163-163
UniProt: Binding site:166-167
UniProt: Binding site:242-242
UniProt: Binding site:245-245
UniProt: Binding site:268-268
UniProt: Binding site:351-351
UniProt: Binding site:37-38
UniProt: Binding site:74-74
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3H447
AlphaFold DB full sequence Viewing
ColabFold KP13_00662
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records
Transferred evidence 8 records from similar proteins
Structural ligands 7 0 loaded crystals
Measured bioactivity 1 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
3GQ PDB via homolog 210.1 Da · LogP 0.78 · TPSA 111.9 Open detail RCSB PDB
4NO PDB via homolog Detail RCSB PDB
CAC PDB via homolog Detail RCSB PDB
DHL PDB via homolog Detail RCSB PDB
HSE PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3GQ RCSB PDB Q8DQ00 210.1 Da LogP 0.78 TPSA 111.9 ✓ Ro5 ✓ Clean c1cc(c(c(c1)C(=O)O)C(=O)O)C(=O)O
4NO RCSB PDB Q9KQG2 247.1 Da LogP 0.10 TPSA 138.0 ✓ Ro5 ✓ Clean c1cc(c(cc1[N+](=O)[O-])P(=O)(O)O)C(=O)O
CAC RCSB PDB P44801 137.0 Da LogP -0.52 TPSA 40.1 ✓ Ro5 ✓ Clean C[As](=O)(C)[O-]
DHL RCSB PDB Q8DQ00 77.2 Da LogP -0.13 TPSA 26.0 ✓ Ro5 ✓ Clean C(CS)N
HSE RCSB PDB P44801 119.1 Da LogP -1.22 TPSA 83.5 ✓ Ro5 ✓ Clean C(CO)[C@@H](C(=O)O)N
OEG RCSB PDB P23247 134.1 Da LogP -0.83 TPSA 83.8 ✓ Ro5 ✓ Clean C(C(=O)O)OCC(=O)O
PEJ RCSB PDB P44801 190.9 Da LogP -7.75 TPSA 92.2 ✓ Ro5 ✓ Clean [O-]I(=O)(=O)=O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.