KpKP13 Protein target profile

Large-conductance mechanosensitive channel

Accession: KP13_00777

Gene: mscL AHE42390.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GWI1
Export view
Length 137
Pocket druggability (P2Rank · AlphaFold DB model) 0.093
Functional annotation 0 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Moderate predicted binding pocket FPocket selected-pocket score 0.58. This supports review but is not experimental validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 1109 of 4744 screened genomes (23.4%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.58) — check the ligand evidence before deprioritizing on off-target risk alone. Weak second pocket-predictor signal P2Rank predicted binding-site probability 0.09.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
23.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
93.431 Higher values support similarity to known essential genes.
DEG E-value
4.25e-89 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
84.94 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.093
Structure A0A0H3GWI1
Pocket Pocket 1
Druggability (FPocket) 0.578
Structure A0A0H3GWI1
Pocket Pocket 5
ColabFold model
P2Rank 0.03 · Pocket 1
FPocket 0.704 · Pocket 5
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 1109 / 4744 genomes with a hit
Prevalence 23.4%

Sequence

Primary amino-acid sequence viewer.

MSFLKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDVPAVVMHYGVFIQNVFDFIIVAFAIFMAIKLMNKLNRKKEEAPAAPPAPSKEEVLLSEIRDLLKEQNNRS

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

4
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0034220 A process in which a monoatomic ion is transported across a membrane. Monatomic ions (also called simple ions) are ions consisting of exactly one atom.
  • GO:0008381 Enables the transmembrane transfer of an monoatomic ion by a channel that opens in response to a mechanical stress.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

28 records
Show feature table
Start End DB Term Name
84 92 PRINTS PR01264 Bacterial mechano-sensitive ion channel signature
84 92 InterPro IPR001185 Large-conductance mechanosensitive channel
93 102 PRINTS PR01264 Bacterial mechano-sensitive ion channel signature
93 102 InterPro IPR001185 Large-conductance mechanosensitive channel
6 20 PRINTS PR01264 Bacterial mechano-sensitive ion channel signature
6 20 InterPro IPR001185 Large-conductance mechanosensitive channel
3 134 FunFam G3DSA:1.10.1200.120:FF:000001 Large-conductance mechanosensitive channel
3 132 Hamap MF_00115 Large-conductance mechanosensitive channel [mscL].
3 132 InterPro IPR001185 Large-conductance mechanosensitive channel
97 137 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
3 131 Pfam PF01741 Large-conductance mechanosensitive channel, MscL
3 131 InterPro IPR037673 Large-conductance mechanosensitive channel/anditomin synthesis protein L
74 96 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
12 127 SUPERFAMILY SSF81330 Gated mechanosensitive channel
12 127 InterPro IPR036019 Large-conductance mechanosensitive channel MscL
1 20 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
13 26 ProSitePatterns PS01327 Large-conductance mechanosensitive channels mscL family signature.
13 26 InterPro IPR019823 Large-conductance mechanosensitive channel, conserved site
21 52 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
53 71 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
72 96 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
20 42 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
3 133 NCBIfam TIGR00220 large conductance mechanosensitive channel protein MscL
3 133 InterPro IPR001185 Large-conductance mechanosensitive channel
3 134 Gene3D G3DSA:1.10.1200.120 -
3 134 InterPro IPR036019 Large-conductance mechanosensitive channel MscL
2 136 PANTHER PTHR30266 MECHANOSENSITIVE CHANNEL MSCL
2 136 InterPro IPR037673 Large-conductance mechanosensitive channel/anditomin synthesis protein L

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.093
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #5
0.578
Show in viewer
Surrounding area
Pocket 2 FPocket #2
0.554 Unusual size
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GWI1
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_00777
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GWI1