Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 1.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 53.03 Higher values support similarity to known essential genes.
- DEG E-value
- 7.3e-78 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 89.71 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MARKTKEEAQRTRQLLIESAIQQFALRGVTNTTLTDIADAAGVTRGAVYWHFASKTELFNEMWQQQPPLRDLIQPSQAIEYEQEPLNALRERFIAGLRYIAANPRQRALMQILYQRCEFSSDMLSEYEIRQRIGFNYSLIGGILQCCVRNNILPAETNIEMILIVLHSAFSGLIKNWLLDPQRFDLYQQAPALVDNIMAVVCAARLSGGPALRLVNQ
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
4- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
- GO:0045892 Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0009410 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a xenobiotic, a compound foreign to the organism exposed to it. It may be synthesized by another organism (like ampicilin) or it can be a synthetic chemical.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 207 | FunFam | G3DSA:1.10.357.10:FF:000003 | HTH-type transcriptional regulator AcrR |
| 1 | 179 | PANTHER | PTHR43479 | ACREF/ENVCD OPERON REPRESSOR-RELATED |
| 16 | 62 | Pfam | PF00440 | Bacterial regulatory proteins, tetR family |
| 16 | 62 | InterPro | IPR001647 | DNA-binding HTH domain, TetR-type |
| 1 | 206 | Gene3D | G3DSA:1.10.357.10 | Tetracycline Repressor, domain 2 |
| 85 | 199 | SUPERFAMILY | SSF48498 | Tetracyclin repressor-like, C-terminal domain |
| 85 | 199 | InterPro | IPR036271 | Tetracyclin repressor-like, C-terminal domain superfamily |
| 37 | 60 | PRINTS | PR00455 | TetR bacterial regulatory protein HTH signature |
| 37 | 60 | InterPro | IPR001647 | DNA-binding HTH domain, TetR-type |
| 16 | 29 | PRINTS | PR00455 | TetR bacterial regulatory protein HTH signature |
| 16 | 29 | InterPro | IPR001647 | DNA-binding HTH domain, TetR-type |
| 10 | 70 | ProSiteProfiles | PS50977 | TetR-type HTH domain profile. |
| 10 | 70 | InterPro | IPR001647 | DNA-binding HTH domain, TetR-type |
| 84 | 199 | Pfam | PF08361 | MAATS-type transcriptional repressor, C-terminal region |
| 84 | 199 | InterPro | IPR013572 | Transcription regulator MAATS, C-terminal |
| 1 | 65 | SUPERFAMILY | SSF46689 | Homeodomain-like |
| 1 | 65 | InterPro | IPR009057 | Homeobox-like domain superfamily |
| 28 | 58 | ProSitePatterns | PS01081 | TetR-type HTH domain signature. |
| 28 | 58 | InterPro | IPR023772 | DNA-binding HTH domain, TetR-type, conserved site |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GWG4
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02950
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC2004372 ZINC | 1.000 | 221.3 Da LogP 1.19 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCNC1CCCCC1
|
| ZINC38364153 ZINC | 0.926 | 235.3 Da LogP 1.58 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCNC1CCCCC1
|
| ZINC1710230 ZINC | 0.786 | 207.3 Da LogP 0.80 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCNC1CCCCC1
|
| ZINC2027016 ZINC | 0.655 | 255.1 Da LogP 4.49 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
Oc1cc(Cl)ccc1Oc1ccc(Cl)cc1
|
| ZINC5188799 ZINC | 0.630 | 280.5 Da LogP 4.39 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
C(CCCNC1CCCCC1)CCNC1CCCCC1
|
| ZINC13559000 ZINC | 0.613 | 220.7 Da LogP 3.84 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
Oc1cc(Cl)ccc1Oc1ccccc1
|
| ZINC6093097 ZINC | 0.613 | 255.1 Da LogP 4.49 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
Oc1ccc(Oc2ccc(Cl)cc2Cl)cc1
|
| ZINC13467758 ZINC | 0.559 | 257.1 Da LogP 3.28 TPSA 55.2 | ✓ Ro5 | ✓ Clean |
Oc1ncc(Oc2ccc(Cl)cc2Cl)cn1
|
| ZINC100468172 ZINC | 0.556 | 282.1 Da LogP 4.59 TPSA 41.8 | ✓ Ro5 | ✓ Clean |
O/N=C\c1ccccc1Oc1ccc(Cl)cc1Cl
|
| ZINC105166 ZINC | 0.545 | 254.1 Da LogP 4.37 TPSA 35.2 | ✓ Ro5 | ✓ Clean |
Nc1ccccc1Oc1ccc(Cl)cc1Cl
|
| ZINC168388 ZINC | 0.543 | 269.1 Da LogP 4.28 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
OCc1ccccc1Oc1ccc(Cl)cc1Cl
|
| ZINC77319724 ZINC | 0.543 | 369.6 Da LogP 4.62 TPSA 72.8 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)Oc1cc(Cl)ccc1Oc1ccc(Cl)cc1Cl
|
| ZINC2509149 ZINC | 0.531 | 211.4 Da LogP 4.27 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNC1CCCCC1
|
| ZINC71867312 ZINC | 0.531 | 212.6 Da LogP 2.94 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
Oc1cc(Cl)ccc1OC(F)(F)F
|
| ZINC130127586 ZINC | 0.529 | 260.4 Da LogP 1.38 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=S(=O)(NCCNC1CCCCCC1)C1CC1
|
| ZINC20474910 ZINC | 0.529 | 272.1 Da LogP 4.51 TPSA 35.2 | ✓ Ro5 | ✓ Clean |
Nc1ccc(Oc2ccc(Cl)cc2Cl)c(F)c1
|
| ZINC21501863 ZINC | 0.528 | 283.1 Da LogP 4.48 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccccc1Oc1ccc(Cl)cc1Cl
|
| ZINC19367005 ZINC | 0.519 | 224.4 Da LogP 2.83 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
C1CCC(NCCNC2CCCCC2)CC1
|
| ZINC1671466 ZINC | 0.516 | 380.0 Da LogP 4.81 TPSA 52.6 | ✓ Ro5 | ✓ Clean |
O=C(Oc1ccc(Cl)cc1Cl)C(=O)Oc1ccc(Cl)cc1Cl
|
| ZINC2018978 ZINC | 0.515 | 254.1 Da LogP 4.37 TPSA 35.2 | ✓ Ro5 | Alert |
Nc1ccc(Oc2ccc(Cl)cc2Cl)cc1
|
| ZINC6244372 ZINC | 0.515 | 241.1 Da LogP 3.58 TPSA 35.0 | ✓ Ro5 | ✓ Clean |
Clc1ccc(Oc2ncccn2)c(Cl)c1
|
| ZINC118075337 ZINC | 0.514 | 347.6 Da LogP 4.90 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
O=C(O)COc1cc(Cl)ccc1Oc1ccc(Cl)cc1Cl
|
| ZINC118077995 ZINC | 0.514 | 347.6 Da LogP 4.34 TPSA 55.8 | ✓ Ro5 | ✓ Clean |
O=C(CO)Oc1cc(Cl)ccc1Oc1ccc(Cl)cc1Cl
|
| ZINC1428 ZINC | 0.514 | 297.1 Da LogP 4.41 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)Cc1ccccc1Oc1ccc(Cl)cc1Cl
|
| ZINC254823 ZINC | 0.514 | 342.1 Da LogP 3.76 TPSA 109.9 | ✓ Ro5 | ✓ Clean |
Nc1cc(C(=O)O)c(Oc2ccc(Cl)cc2Cl)cc1C(=O)O
|
| ZINC17886718 ZINC | 0.513 | 289.1 Da LogP 3.94 TPSA 58.1 | ✓ Ro5 | ✓ Clean |
Oc1[nH]c(=S)ncc1Oc1ccc(Cl)cc1Cl
|
| ZINC11955788 ZINC | 0.500 | 283.1 Da LogP 4.48 TPSA 46.5 | ✓ Ro5 | ✓ Clean |
O=C(O)c1ccc(Oc2ccc(Cl)cc2Cl)cc1
|
| ZINC140803 ZINC | 0.500 | 264.1 Da LogP 4.66 TPSA 33.0 | ✓ Ro5 | ✓ Clean |
N#Cc1ccccc1Oc1ccc(Cl)cc1Cl
|
| ZINC159467 ZINC | 0.500 | 282.2 Da LogP 4.85 TPSA 12.5 | ✓ Ro5 | ✓ Clean |
CN(C)c1ccccc1Oc1ccc(Cl)cc1Cl
|
| ZINC1672446 ZINC | 0.500 | 228.3 Da LogP 1.49 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC1CCCCC1)C(=O)O
|
| ZINC167666 ZINC | 0.500 | 267.1 Da LogP 4.60 TPSA 26.3 | ✓ Ro5 | ✓ Clean |
O=Cc1ccccc1Oc1ccc(Cl)cc1Cl
|
| ZINC2168583 ZINC | 0.500 | 237.3 Da LogP 0.16 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)C[C@@H](O)CNC1CCCCC1
|
| ZINC2168584 ZINC | 0.500 | 237.3 Da LogP 0.16 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)C[C@H](O)CNC1CCCCC1
|
| ZINC236994621 ZINC | 0.500 | 290.4 Da LogP 0.85 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CCS(=O)(=O)CC(=O)NCCNC1CCCCCC1
|
| ZINC39437762 ZINC | 0.500 | 220.7 Da LogP 3.84 TPSA 29.5 | ✓ Ro5 | ✓ Clean |
Oc1ccccc1Oc1ccccc1Cl
|
| ZINC44655186 ZINC | 0.500 | 213.4 Da LogP 3.12 TPSA 21.3 | ✓ Ro5 | ✓ Clean |
COCCCCNC1CCCCCCC1
|
| ZINC5840523 ZINC | 0.500 | 228.3 Da LogP 1.49 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC1CCCCC1)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.