KpKP13 Protein target profile

Protein-export membrane protein secG

Accession: KP13_01107

Gene: AHE42499.1 secG 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GY13
Export view
Length 109
Pocket druggability (FPocket · AlphaFold DB model) 0.783
Functional annotation 0 EC 6 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.78. This is a computational pocket signal, not binding validation. Structure available AlphaFold DB model + ColabFold model

Risks to review

Microbiome similarity 161 of 4744 screened genomes (3.4%) have a significant similarity hit. This target also has a predicted binding pocket (FPocket 0.78) — check the ligand evidence before deprioritizing on off-target risk alone. Mixed conservation Core/accessory calls are not fully concordant.

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
3.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
Y
DEG identity (%)
89.091 Higher values support similarity to known essential genes.
DEG E-value
6.35e-67 Smaller values mean stronger essential-gene similarity.

Structure confidence

ColabFold pLDDT
65.83 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank)
Structure A0A0H3GY13
Pocket No pockets
Druggability (FPocket) 0.783
Structure A0A0H3GY13
Pocket Pocket 5
ColabFold model
P2Rank 0.007 · Pocket 1
FPocket 0.86 · Pocket 10
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 161 / 4744 genomes with a hit
Prevalence 3.4%

Sequence

Primary amino-acid sequence viewer.

MYEALLVVFLIVAIGLVGLVMLQQGKGADMGASFGAGASGTLFGSSGSGNFMTRMTGILAALFFIISLALGNINSNKTSKGSEWDNLSAPKTEQTQPTAPAQPTSDIPH

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Subcellular localization

Localization
CytoplasmicMembrane

Gene Ontology (GO)

6
  • GO:0009306 The controlled release of proteins from a cell.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0015450 Primary active carrier-mediated transport of a protein across a membrane, driven by the hydrolysis of the diphosphate bond of inorganic pyrophosphate, ATP, or another nucleoside triphosphate. The transport protein may or may not be transiently phosphorylated, but the substrate is not phosphorylated.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0065002 The directed movement of proteins in a cell, from one side of a membrane to another by means of some agent such as a transporter or pore.
  • GO:0043952 The process in which unfolded proteins are transported across the cytoplasmic membrane in Gram-positive and Gram-negative bacteria by the Sec complex, in a process involving proteolytic cleavage of an N-terminal signal peptide.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
5 22 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
51 70 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
71 109 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
81 109 MobiDBLite mobidb-lite consensus disorder prediction
3 74 NCBIfam TIGR00810 preprotein translocase subunit SecG
3 74 InterPro IPR004692 Preprotein translocase SecG subunit
1 101 PANTHER PTHR34182 PROTEIN-EXPORT MEMBRANE PROTEIN SECG
1 101 InterPro IPR004692 Preprotein translocase SecG subunit
51 73 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
38 54 PRINTS PR01651 Protein-export SecG membrane protein signature
38 54 InterPro IPR004692 Preprotein translocase SecG subunit
54 76 PRINTS PR01651 Protein-export SecG membrane protein signature
54 76 InterPro IPR004692 Preprotein translocase SecG subunit
3 23 PRINTS PR01651 Protein-export SecG membrane protein signature
3 23 InterPro IPR004692 Preprotein translocase SecG subunit
23 37 PRINTS PR01651 Protein-export SecG membrane protein signature
23 37 InterPro IPR004692 Preprotein translocase SecG subunit
23 27 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
28 50 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
4 22 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 27 Phobius SIGNAL_PEPTIDE Signal peptide region
5 72 Pfam PF03840 Preprotein translocase SecG subunit
5 72 InterPro IPR004692 Preprotein translocase SecG subunit

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #5
0.783
Show in viewer
Surrounding area
Pocket 2 FPocket #3
0.64
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GY13
AlphaFold DB — — full sequence — Viewing
ColabFold KP13_01107
ColabFold — — full sequence — Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GY13