KpKP13 Protein target profile

peptidase C56 protein

Accession: KP13_01084

Gene: AHE42523.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GYV3

Export view

Length 178

Pocket druggability (P2Rank · AlphaFold DB model) 0.061

Direct ligand evidence 0 104 total records

Functional annotation 0 EC 0 GO

Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Main supporting evidence

Core gene across strains Marked as conserved by both pan-genome tools: Roary and CoreCruncher. Moderate predicted binding pocket FPocket selected-pocket score 0.63. This supports review but is not experimental validation. Structure available AlphaFold DB model + ColabFold model Ligand evidence via structure/bioactivity 16 structural and 38 bioactivity records.

Risks to review

Evidence gaps

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target: Hit
Human identity (%): 27.848 Lower values reduce human off-target concern.
Human E-value: 2.99e-06
Gut microbiome similarity: 2.4% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG): N
DEG identity (%): 0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT: 96.25 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.061

Structure A0A0H3GYV3

Pocket Pocket 1

Druggability (FPocket) 0.627

Structure A0A0H3GYV3

Pocket Pocket 2

ColabFold model

P2Rank 0.138 · Pocket 1

FPocket 0.421 · Pocket 5

Core conservation Conserved core gene

Roary core

CoreCruncher core

Gut microbiome 116 / 4744 genomes with a hit

Prevalence 2.4%

Sequence

Primary amino-acid sequence viewer.

MSKKIAVLITDDFEDSEFTSPAEAFKLAGHQVITIEKQAGKTVKGKQGEAEVAIDRAIDDVTPGEFDALLLPGGYSPDQLRGDERFVTFTRDFVNGGKPVFAICHGPQLLISADVIRGRKLTAVKPIVVDVKNAGGEFYDQEVVVDNEQLVTSRTPDDLPAFNREALRLLGAGITPPV

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

Subcellular localization

Localization: Cytoplasmic

No GO or EC annotations are currently loaded for this protein.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records

Show feature table

Start	End	DB	Term	Name
4	171	NCBIfam	TIGR01382	DJ-1/PfpI/YhbO family deglycase/protease
4	171	InterPro	IPR006286	Deglycase PfpI-like
1	170	SUPERFAMILY	SSF52317	Class I glutamine amidotransferase-like
1	170	InterPro	IPR029062	Class I glutamine amidotransferase-like
7	178	ProSiteProfiles	PS51273	Glutamine amidotransferase type 1 domain profile.
3	171	ProSiteProfiles	PS51276	PfpI endopeptidase domain profile.
3	171	InterPro	IPR006286	Deglycase PfpI-like
1	172	FunFam	G3DSA:3.40.50.880:FF:000017	Type 1 glutamine amidotransferase
1	172	Gene3D	G3DSA:3.40.50.880	-
1	172	InterPro	IPR029062	Class I glutamine amidotransferase-like
2	172	PANTHER	PTHR42733	DJ-1 PROTEIN
2	172	InterPro	IPR006286	Deglycase PfpI-like
3	167	Pfam	PF01965	DJ-1/PfpI family
3	167	InterPro	IPR002818	DJ-1/PfpI
4	169	CDD	cd03134	GATase1_PfpI_like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low

How colors and pocket overlays are used

Uniform protein color marks the displayed model as a single molecular object.

Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.

Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.

'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.

'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.

'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.

Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1

0.061

Show in viewer

Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #2

0.627

Show in viewer

Surrounding area

All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold DB AF_A0A0H3GYV3	AlphaFold DB	—	—	full sequence	—	Viewing
ColabFold KP13_01084	ColabFold	—	—	full sequence	—	Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

104 records

Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 same-protein records

Transferred evidence 54 records from similar proteins

Structural ligands 16 0 loaded crystals

Measured bioactivity 38 direct and transferred ChEMBL records

Proposed compounds 50 similarity-based ZINC candidates

Best available ligand signal

2HA PDB via homolog 90.1 Da · LogP -1.46 · TPSA 57.5 Open detail RCSB PDB

72R PDB via homolog Detail RCSB PDB

72S PDB via homolog Detail RCSB PDB

72T PDB via homolog Detail RCSB PDB

72U PDB via homolog Detail RCSB PDB

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
2HA RCSB PDB	6F2F	O59413	90.1 Da LogP -1.46 TPSA 57.5	✓ Ro5	✓ Clean	`C(C(=O)CO)O`
72R RCSB PDB	6AFC	Q99497	165.1 Da LogP 0.96 TPSA 46.2	✓ Ro5	✓ Clean	`c1cc2c(cc1F)C(=O)C(=O)N2`
72S RCSB PDB	6AFD	Q99497	161.2 Da LogP 1.13 TPSA 46.2	✓ Ro5	✓ Clean	`Cc1cccc2c1NC(=O)C2=O`
72T RCSB PDB	6AFE	Q99497	215.1 Da LogP 1.84 TPSA 46.2	✓ Ro5	✓ Clean	`c1cc2c(c(c1)C(F)(F)F)NC(=O)C2=O`
72U RCSB PDB	6AFF	Q99497	205.2 Da LogP 0.61 TPSA 72.5	✓ Ro5	✓ Clean	`COC(=O)c1cccc2c1NC(=O)C2=O`
72V RCSB PDB	6AFG	Q99497	161.2 Da LogP 0.85 TPSA 37.4	✓ Ro5	✓ Clean	`CN1c2ccccc2C(=O)C1=O`
73D RCSB PDB	6AFI	Q99497	175.2 Da LogP 1.24 TPSA 37.4	✓ Ro5	✓ Clean	`CCN1c2ccccc2C(=O)C1=O`
73G RCSB PDB	6AFJ	Q99497	261.3 Da LogP 1.56 TPSA 63.7	✓ Ro5	✓ Clean	`CCCCOC(=O)CN1c2ccccc2C(=O)C1=O`
7MT RCSB PDB	6F2F	O59413	556.4 Da LogP -2.25 TPSA 64.8	1 viol.	✓ Clean	`c1cc2[n+]3c(c1)C(=O)O[Tb]34567[n+]8c(cccc8C(=O)…`
DTT RCSB PDB	5SY6	Q99497	154.3 Da LogP -0.43 TPSA 40.5	✓ Ro5	✓ Clean	`C([C@@H]([C@H](CS)O)O)S`
ISN RCSB PDB	6AF5	Q99497	147.1 Da LogP 0.82 TPSA 46.2	✓ Ro5	✓ Clean	`c1ccc2c(c1)C(=O)C(=O)N2`
MLA RCSB PDB	3CZA	Q99497	104.1 Da LogP -0.45 TPSA 74.6	✓ Ro5	✓ Clean	`C(C(=O)O)C(=O)O`
MLI RCSB PDB	6HF6	O59413	102.0 Da LogP -3.12 TPSA 80.3	✓ Ro5	✓ Clean	`C(C(=O)[O-])C(=O)[O-]`
P15 RCSB PDB	4P36	Q99497	296.4 Da LogP -0.29 TPSA 75.6	✓ Ro5	✓ Clean	`COCCOCCOCCOCCOCCOCCO`
P4C RCSB PDB	3CZ9	Q99497	324.4 Da LogP -0.72 TPSA 92.7	✓ Ro5	✓ Clean	`C(COCCOCCOCCOCCOCCOCC=O)O`
TLA RCSB PDB	5IP5	Q99497	150.1 Da LogP -2.12 TPSA 115.1	✓ Ro5	✓ Clean	`[C@@H]([C@H](C(=O)O)O)(C(=O)O)O`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

Ligand	UniProt (homolog)	pchembl	MW · LogP · TPSA	Lipinski	PAINS	SMILES
CHEMBL5559797 ChEMBL	Q99497	7.72 ~19.1 nM	466.5 Da LogP 1.80 TPSA 120.0	✓ Ro5	✓ Clean	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cc(-n4c…`
CHEMBL5559582 ChEMBL	Q99497	7.68 ~20.9 nM	530.6 Da LogP 1.10 TPSA 135.9	1 viol.	✓ Clean	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cccc(S(…`
CHEMBL5202724 ChEMBL	Q99497	7.26 ~55.0 nM	299.3 Da LogP 2.61 TPSA 46.6	✓ Ro5	✓ Clean	`COc1cc(F)cc2c1N(CCc1ccccc1)C(=O)C2=O`
DWT ChEMBL	Q99497	7.26 ~55.0 nM	503.5 Da LogP 5.75 TPSA 97.6	2 viol.	✓ Clean	`Cc1ccc(cc1Nc2c3cn(nc3nc(n2)c4cccnc4)C)C(=O)Nc5c…`
CHEMBL406190 ChEMBL	Q99497	7.20 ~63.1 nM	409.1 Da LogP 3.98 TPSA 37.4	✓ Ro5	✓ Clean	`O=C1C(=O)N(CCc2ccccc2)c2c(Br)cc(Br)cc21`
CHEMBL5192433 ChEMBL	Q99497	7.07 ~85.1 nM	289.7 Da LogP 3.69 TPSA 20.3	✓ Ro5	✓ Clean	`O=C1C(Cl)c2cc(F)ccc2N1CCc1ccccc1`
73H ChEMBL	Q99497	6.93 ~117.5 nM	269.3 Da LogP 2.60 TPSA 37.4	✓ Ro5	✓ Clean	`c1ccc(cc1)CCN2c3ccc(cc3C(=O)C2=O)F`
CHEMBL5176828 ChEMBL	Q99497	6.93 ~117.5 nM	193.2 Da LogP 1.37 TPSA 37.4	✓ Ro5	✓ Clean	`CCN1C(=O)C(=O)c2cc(F)ccc21`
CHEMBL4802053 ChEMBL	Q99497	6.92 ~120.2 nM	360.4 Da LogP 1.08 TPSA 138.1	✓ Ro5	Alert	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)CN=[N+]=[…`
CHEMBL5205386 ChEMBL	Q99497	6.75 ~177.8 nM	262.3 Da LogP 3.47 TPSA 34.1	✓ Ro5	Alert	`O=C1C=C(CCc2ccccc2)c2ccccc2C1=O`
CHEMBL395485 ChEMBL	Q99497	6.57 ~269.2 nM	425.1 Da LogP 3.95 TPSA 46.6	✓ Ro5	✓ Clean	`COc1ccc(CN2C(=O)C(=O)c3cc(Br)cc(Br)c32)cc1`
CHEMBL5183846 ChEMBL	Q99497	6.45 ~354.8 nM	295.3 Da LogP 3.09 TPSA 37.4	✓ Ro5	✓ Clean	`O=C1C(=O)N(CC2(c3ccccc3)CC2)c2ccc(F)cc21`
CHEMBL5209355 ChEMBL	Q99497	6.29 ~512.9 nM	349.3 Da LogP 1.18 TPSA 88.2	✓ Ro5	✓ Clean	`C#CCOc1cc2ccccc2cc1C(=O)NC1=CC(=O)C2OC2C1O`
CHEMBL244322 ChEMBL	Q99497	6.17 ~676.1 nM	409.1 Da LogP 4.25 TPSA 37.4	✓ Ro5	✓ Clean	`Cc1ccc(CN2C(=O)C(=O)c3cc(Br)cc(Br)c32)cc1`
CHEMBL5200261 ChEMBL	Q99497	6.16 ~691.8 nM	273.3 Da LogP 3.43 TPSA 20.3	✓ Ro5	✓ Clean	`O=C1C(F)c2cc(F)ccc2N1CCc1ccccc1`
73F ChEMBL	Q99497	6.15 ~707.9 nM	251.3 Da LogP 2.46 TPSA 37.4	✓ Ro5	✓ Clean	`c1ccc(cc1)CCN2c3ccccc3C(=O)C2=O`
CHEMBL5198554 ChEMBL	Q99497	6.07 ~851.1 nM	249.3 Da LogP 2.79 TPSA 37.4	✓ Ro5	✓ Clean	`CC(C)(C)CCN1C(=O)C(=O)c2cc(F)ccc21`
CHEMBL5177048 ChEMBL	Q99497	—	225.7 Da LogP 3.38 TPSA 29.1	✓ Ro5	✓ Clean	`CCC(C)c1ccc(NC(=O)CCl)cc1`
CHEMBL5185941 ChEMBL	Q99497	—	688.6 Da LogP 4.27 TPSA 128.0	1 viol.	✓ Clean	`CC1=CC(C)=[N+]2C1=C(CCCCc1cn(CC(=O)N3CCc4nc(NC(…`
CHEMBL5188645 ChEMBL	Q99497	—	479.6 Da LogP 1.38 TPSA 122.5	✓ Ro5	✓ Clean	`CN1C(=O)CC(C(=O)N2CCc3nc(NC(=O)[C@H]4CCN(C#N)C4…`
CHEMBL5191068 ChEMBL	Q99497	—	1082.3 Da LogP 5.71 TPSA 267.0	3 viol.	✓ Clean	`CC[N+]1=C(/C=C/C=C/C=C2/N(CCCCCC(=O)NCCCc3cn(CC…`
CHEMBL5193433 ChEMBL	Q99497	—	396.5 Da LogP 1.41 TPSA 102.2	✓ Ro5	✓ Clean	`N#CN1CC[C@H](C(=O)Nc2nc3c(s2)CN(C(=O)Cc2ccncc2)…`
CHEMBL5196840 ChEMBL	Q99497	—	204.6 Da LogP 1.87 TPSA 54.4	✓ Ro5	✓ Clean	`O=C(O)c1csc(C(=O)CCl)c1`
CHEMBL5196847 ChEMBL	Q99497	—	440.4 Da LogP 2.33 TPSA 89.3	✓ Ro5	✓ Clean	`N#CN1CC[C@H](C(=O)Nc2nc3c(s2)CN(C(=O)CCCCBr)CC3…`
CHEMBL5202220 ChEMBL	Q99497	—	799.9 Da LogP 3.70 TPSA 249.4	2 viol.	✓ Clean	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)Cn2cc(CCC…`
CHEMBL5204865 ChEMBL	Q99497	—	332.3 Da LogP 0.83 TPSA 113.2	✓ Ro5	✓ Clean	`O=c1ccc(NS(=O)(=O)c2cccc(S(=O)(=O)F)c2)c[nH]1`
CHEMBL5527958 ChEMBL	Q99497	—	500.6 Da LogP 1.52 TPSA 135.5	1 viol.	✓ Clean	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cccc(S(…`
CHEMBL5532418 ChEMBL	Q99497	—	572.7 Da LogP 2.66 TPSA 135.9	1 viol.	✓ Clean	`COc1ccc(C(=O)N2CCc3nc(NC(=O)[C@@H]4CCN(C#N)C4)s…`
CHEMBL5532466 ChEMBL	Q99497	—	1334.6 Da LogP 5.86 TPSA 324.6	3 viol.	✓ Clean	`CC[N+]1=C(/C=C/C=C/C=C2/N(CCCCCC(=O)NCCCc3cn(CC…`
CHEMBL5557416 ChEMBL	Q99497	—	478.6 Da LogP 3.52 TPSA 102.2	✓ Ro5	✓ Clean	`Cc1csc(-c2cccc(C(=O)N3CCc4nc(NC(=O)[C@@H]5CCN(C…`
CHEMBL5561942 ChEMBL	Q99497	—	535.1 Da LogP 2.28 TPSA 126.7	1 viol.	✓ Clean	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2ccc(Cl)…`
CHEMBL5564608 ChEMBL	Q99497	—	449.5 Da LogP 2.13 TPSA 128.2	✓ Ro5	✓ Clean	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cccc(-c…`
CHEMBL5565792 ChEMBL	Q99497	—	397.5 Da LogP 1.79 TPSA 109.6	✓ Ro5	✓ Clean	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cccc(O)…`
CHEMBL5567367 ChEMBL	Q99497	—	1162.4 Da LogP 7.45 TPSA 267.0	3 viol.	✓ Clean	`CC[N+]1=C(/C=C/C=C/C=C2/N(CCCCCC(=O)NCCCc3cn(-c…`
CHEMBL5567754 ChEMBL	Q99497	—	768.7 Da LogP 6.01 TPSA 128.0	2 viol.	✓ Clean	`CC1=CC(C)=[N+]2C1=C(CCCCc1cn(-c3ccc(F)c(C(=O)N4…`
CHEMBL5567756 ChEMBL	Q99497	—	571.7 Da LogP 0.94 TPSA 147.0	1 viol.	✓ Clean	`CC(=O)N1CCN(S(=O)(=O)c2cccc(C(=O)N3CCc4nc(NC(=O…`
CHEMBL5567767 ChEMBL	Q99497	—	470.6 Da LogP 3.27 TPSA 102.2	✓ Ro5	✓ Clean	`N#CN1CC[C@@H](C(=O)Nc2nc3c(s2)CN(C(=O)c2cnc(-c4…`
CHEMBL5568566 ChEMBL	Q99497	—	474.4 Da LogP 3.15 TPSA 89.3	✓ Ro5	✓ Clean	`Cc1cc(C(=O)N2CCc3nc(NC(=O)[C@@H]4CCN(C#N)C4)sc3…`

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC1580161 ZINC	1.000	208.3 Da LogP -0.33 TPSA 57.2	✓ Ro5	✓ Clean	`COCCOCCOCCOCCO`
ZINC16052118 ZINC	1.000	340.4 Da LogP -0.28 TPSA 84.8	✓ Ro5	✓ Clean	`COCCOCCOCCOCCOCCOCCOCCO`
ZINC16052257 ZINC	1.000	384.5 Da LogP -0.26 TPSA 94.1	✓ Ro5	✓ Clean	`COCCOCCOCCOCCOCCOCCOCCOCCO`
ZINC2268444 ZINC	1.000	251.3 Da LogP 2.46 TPSA 37.4	✓ Ro5	✓ Clean	`O=C1C(=O)N(CCc2ccccc2)c2ccccc21`
ZINC2332288 ZINC	1.000	205.2 Da LogP 0.61 TPSA 72.5	✓ Ro5	✓ Clean	`COC(=O)c1cccc2c1NC(=O)C2=O`
ZINC2487385 ZINC	1.000	215.1 Da LogP 1.84 TPSA 46.2	✓ Ro5	✓ Clean	`O=C1Nc2c(cccc2C(F)(F)F)C1=O`
ZINC34317654 ZINC	1.000	472.6 Da LogP -0.23 TPSA 112.5	1 viol.	✓ Clean	`COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO`
ZINC44076059 ZINC	1.000	428.5 Da LogP -0.24 TPSA 103.3	✓ Ro5	✓ Clean	`COCCOCCOCCOCCOCCOCCOCCOCCOCCO`
ZINC5210101 ZINC	1.000	252.3 Da LogP -0.31 TPSA 66.4	✓ Ro5	✓ Clean	`COCCOCCOCCOCCOCCO`
ZINC5423920 ZINC	1.000	269.3 Da LogP 2.60 TPSA 37.4	✓ Ro5	✓ Clean	`O=C1C(=O)N(CCc2ccccc2)c2ccc(F)cc21`
ZINC5997860 ZINC	1.000	296.4 Da LogP -0.29 TPSA 75.6	✓ Ro5	✓ Clean	`COCCOCCOCCOCCOCCOCCO`
ZINC9583261 ZINC	1.000	261.3 Da LogP 1.56 TPSA 63.7	✓ Ro5	✓ Clean	`CCCCOC(=O)CN1C(=O)C(=O)c2ccccc21`
ZINC2983461 ZINC	0.818	265.3 Da LogP 2.85 TPSA 37.4	✓ Ro5	✓ Clean	`O=C1C(=O)N(CCCc2ccccc2)c2ccccc21`
ZINC4744603 ZINC	0.800	344.2 Da LogP 3.80 TPSA 37.4	✓ Ro5	✓ Clean	`Cc1ccc(CN2C(=O)C(=O)c3cc(Br)cc(C)c32)cc1`
ZINC5234823 ZINC	0.795	360.2 Da LogP 3.50 TPSA 46.6	✓ Ro5	✓ Clean	`COc1ccc(CN2C(=O)C(=O)c3cc(Br)cc(C)c32)cc1`
ZINC16946235 ZINC	0.759	241.2 Da LogP 2.63 TPSA 46.2	✓ Ro5	✓ Clean	`O=C1Nc2ccc(-c3ccc(F)cc3)cc2C1=O`
ZINC253787 ZINC	0.758	205.3 Da LogP 3.55 TPSA 29.1	✓ Ro5	✓ Clean	`CCC(=O)Nc1ccc([C@H](C)CC)cc1`
ZINC253788 ZINC	0.758	205.3 Da LogP 3.55 TPSA 29.1	✓ Ro5	✓ Clean	`CCC(=O)Nc1ccc([C@@H](C)CC)cc1`
ZINC1722373 ZINC	0.756	233.2 Da LogP 0.78 TPSA 63.7	✓ Ro5	✓ Clean	`CCOC(=O)CN1C(=O)C(=O)c2ccccc21`
ZINC1607937 ZINC	0.750	266.3 Da LogP 2.55 TPSA 40.6	✓ Ro5	✓ Clean	`CN1C(=O)c2ccccc2N(C)C(=O)c2ccccc21`
ZINC373252 ZINC	0.735	233.4 Da LogP 4.18 TPSA 29.1	✓ Ro5	✓ Clean	`CC[C@@H](C)c1ccc(NC(=O)CC(C)C)cc1`
ZINC373254 ZINC	0.735	233.4 Da LogP 4.18 TPSA 29.1	✓ Ro5	✓ Clean	`CC[C@H](C)c1ccc(NC(=O)CC(C)C)cc1`
ZINC3130265 ZINC	0.733	320.3 Da LogP 1.45 TPSA 74.8	✓ Ro5	✓ Clean	`O=C1C(=O)N(CCN2C(=O)C(=O)c3ccccc32)c2ccccc21`
ZINC1613212 ZINC	0.732	261.3 Da LogP 1.63 TPSA 63.7	✓ Ro5	✓ Clean	`CCCCOC(=O)CN1C(=O)c2ccccc2C1=O`
ZINC16974563 ZINC	0.727	238.2 Da LogP 2.50 TPSA 58.2	✓ Ro5	✓ Clean	`O=C1Nc2ccccc2C(=O)Nc2ccccc21`
ZINC575419714 ZINC	0.727	312.4 Da LogP 0.42 TPSA 66.4	✓ Ro5	✓ Clean	`COCCOCCOCCSCCOCCOCCO`
ZINC100643790 ZINC	0.714	290.3 Da LogP 3.43 TPSA 58.2	✓ Ro5	Alert	`Cc1cccc2c1N/C(=C1\Nc3c(C)cccc3C1=O)C2=O`
ZINC104252805 ZINC	0.714	298.2 Da LogP 3.09 TPSA 58.2	✓ Ro5	Alert	`O=C1/C(=C2\Nc3ccc(F)cc3C2=O)Nc2ccc(F)cc21`
ZINC104252809 ZINC	0.714	298.2 Da LogP 3.09 TPSA 58.2	✓ Ro5	Alert	`O=C1/C(=C2/Nc3ccc(F)cc3C2=O)Nc2ccc(F)cc21`
ZINC2173005 ZINC	0.714	306.3 Da LogP 1.40 TPSA 74.8	✓ Ro5	✓ Clean	`O=C1C(=O)N(CN2C(=O)C(=O)c3ccccc32)c2ccccc21`
ZINC462619 ZINC	0.714	233.3 Da LogP 3.12 TPSA 46.2	✓ Ro5	✓ Clean	`CC[C@@H](C)c1ccc(NC(=O)CC(C)=O)cc1`
ZINC462621 ZINC	0.714	233.3 Da LogP 3.12 TPSA 46.2	✓ Ro5	✓ Clean	`CC[C@H](C)c1ccc(NC(=O)CC(C)=O)cc1`
ZINC5456564 ZINC	0.714	219.3 Da LogP 3.94 TPSA 29.1	✓ Ro5	✓ Clean	`CCCC(=O)Nc1ccc([C@@H](C)CC)cc1`
ZINC5456569 ZINC	0.714	219.3 Da LogP 3.94 TPSA 29.1	✓ Ro5	✓ Clean	`CCCC(=O)Nc1ccc([C@H](C)CC)cc1`
ZINC3845334 ZINC	0.711	219.2 Da LogP 1.00 TPSA 72.5	✓ Ro5	✓ Clean	`CCOC(=O)c1cccc2c1NC(=O)C2=O`
ZINC2488440 ZINC	0.707	285.7 Da LogP 3.11 TPSA 37.4	✓ Ro5	✓ Clean	`O=C1C(=O)N(CCc2ccccc2)c2ccc(Cl)cc21`
ZINC2941174 ZINC	0.707	330.2 Da LogP 3.22 TPSA 37.4	✓ Ro5	✓ Clean	`O=C1C(=O)N(CCc2ccccc2)c2ccc(Br)cc21`
ZINC4318197 ZINC	0.707	265.3 Da LogP 2.77 TPSA 37.4	✓ Ro5	✓ Clean	`Cc1ccc2c(c1)C(=O)C(=O)N2CCc1ccccc1`
ZINC9583265 ZINC	0.702	340.2 Da LogP 2.32 TPSA 63.7	✓ Ro5	✓ Clean	`CCCCOC(=O)CN1C(=O)C(=O)c2cc(Br)ccc21`
ZINC115163232 ZINC	0.700	222.3 Da LogP 0.07 TPSA 57.2	✓ Ro5	✓ Clean	`COCCOCCOCCOCCCO`
ZINC258837490 ZINC	0.700	354.4 Da LogP 0.11 TPSA 84.8	✓ Ro5	✓ Clean	`COCCOCCOCCOCCOCCOCCOCCCO`
ZINC1657402 ZINC	0.697	237.3 Da LogP 2.42 TPSA 37.4	✓ Ro5	✓ Clean	`O=C1C(=O)N(Cc2ccccc2)c2ccccc21`
ZINC12359024 ZINC	0.692	210.1 Da LogP -3.40 TPSA 155.5	1 viol.	✓ Clean	`O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O`
ZINC1532740 ZINC	0.692	210.1 Da LogP -3.40 TPSA 155.5	1 viol.	✓ Clean	`O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O`
ZINC23257111 ZINC	0.692	349.4 Da LogP 2.03 TPSA 43.9	✓ Ro5	✓ Clean	`O=C1C(=O)N(CN2CCN(CCc3ccccc3)CC2)c2ccccc21`
ZINC2383134600 ZINC	0.692	290.3 Da LogP 2.55 TPSA 40.6	✓ Ro5	Alert	`CN1C(=O)C(=C2C(=O)N(C)c3ccccc32)c2ccccc21`
ZINC3860635 ZINC	0.692	210.1 Da LogP -3.40 TPSA 155.5	1 viol.	✓ Clean	`O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O`
ZINC45069770 ZINC	0.692	285.3 Da LogP 4.61 TPSA 20.3	✓ Ro5	✓ Clean	`CN1C(=O)c2ccccc2-c2ccccc2-c2ccccc21`
ZINC5526456 ZINC	0.692	220.2 Da LogP 0.60 TPSA 88.0	✓ Ro5	✓ Clean	`COC(=O)c1cccc2c1NC(=O)/C2=N\O`
ZINC6072527 ZINC	0.692	210.1 Da LogP -3.40 TPSA 155.5	1 viol.	✓ Clean	`O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.

Sequence

UniProt A0A0H3GYV3

Chemistry

ChEMBL CHEMBL5559797 ChEMBL CHEMBL5559582 ChEMBL CHEMBL5202724 ChEMBL DWT ChEMBL CHEMBL406190 ChEMBL CHEMBL5192433 ChEMBL 73H ChEMBL CHEMBL5176828 ChEMBL CHEMBL4802053 ChEMBL CHEMBL5205386 ChEMBL CHEMBL395485 ChEMBL CHEMBL5183846 ChEMBL CHEMBL5209355 ChEMBL CHEMBL244322 ChEMBL CHEMBL5200261 ChEMBL 73F ChEMBL CHEMBL5198554 ChEMBL CHEMBL5177048 ChEMBL CHEMBL5185941 ChEMBL CHEMBL5188645 ChEMBL CHEMBL5191068 ChEMBL CHEMBL5193433 ChEMBL CHEMBL5196840 ChEMBL CHEMBL5196847 ChEMBL CHEMBL5202220 ChEMBL CHEMBL5204865 ChEMBL CHEMBL5527958 ChEMBL CHEMBL5532418 ChEMBL CHEMBL5532466 ChEMBL CHEMBL5557416 ChEMBL CHEMBL5561942 ChEMBL CHEMBL5564608 ChEMBL CHEMBL5565792 ChEMBL CHEMBL5567367 ChEMBL CHEMBL5567754 ChEMBL CHEMBL5567756 ChEMBL CHEMBL5567767 ChEMBL CHEMBL5568566