Strong target candidate with converging metabolic, structural and chemical evidence.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 2.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 97.41 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MGQLVDGVWQDTWYDTKSTGGRFKRSVSAFRNWLTADGAAGPSGEGGFAAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFLPVSVVNPLMLENGWTFDDSFPEATGDTLYQHDFLYQLYLHADPHYTGRVTVPVLWDKKQQTIVSNESAEIIRMFNTAFDGLGARAGDYYPPALREQIDELNGWIYDNVNNGVYKAGFATSQQAYDEAVDAVFTSLERLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKRRISDYLNLYGFLRDIYQMPGIAETVSFPHIRHHYYRSHKTINPTGIISIGPQQDLNEPHGRDQRFR
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
2- GO:0004364 Catalysis of the reaction: RX + glutathione = an S-substituted glutathione + a halide anion + H+.
- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 62 | 159 | Pfam | PF13409 | Glutathione S-transferase, N-terminal domain |
| 62 | 159 | InterPro | IPR004045 | Glutathione S-transferase, N-terminal |
| 179 | 327 | Gene3D | G3DSA:1.20.1050.10 | - |
| 172 | 299 | ProSiteProfiles | PS50405 | Soluble glutathione S-transferase C-terminal domain profile. |
| 172 | 299 | InterPro | IPR010987 | Glutathione S-transferase, C-terminal-like |
| 7 | 178 | FunFam | G3DSA:3.40.30.10:FF:000058 | Glutathione S-transferase, omega |
| 1 | 326 | SFLD | SFLDG01206 | Xi.1 |
| 1 | 326 | InterPro | IPR016639 | Glutathione S-transferase Omega/GSH |
| 7 | 178 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin |
| 14 | 327 | PANTHER | PTHR32419 | GLUTATHIONYL-HYDROQUINONE REDUCTASE |
| 14 | 327 | InterPro | IPR016639 | Glutathione S-transferase Omega/GSH |
| 309 | 328 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 179 | 327 | FunFam | G3DSA:1.20.1050.10:FF:000019 | Glutathione S-transferase, omega |
| 174 | 324 | SUPERFAMILY | SSF47616 | GST C-terminal domain-like |
| 174 | 324 | InterPro | IPR036282 | Glutathione S-transferase, C-terminal domain superfamily |
| 203 | 256 | Pfam | PF13410 | Glutathione S-transferase, C-terminal domain |
| 172 | 313 | CDD | cd03190 | GST_C_Omega_like |
| 172 | 313 | InterPro | IPR047047 | Glutathione S-transferases Omega-like, C-terminal |
| 4 | 324 | PIRSF | PIRSF015753 | GST |
| 4 | 324 | InterPro | IPR016639 | Glutathione S-transferase Omega/GSH |
| 41 | 162 | SUPERFAMILY | SSF52833 | Thioredoxin-like |
| 41 | 162 | InterPro | IPR036249 | Thioredoxin-like superfamily |
| 1 | 326 | SFLD | SFLDS00019 | Glutathione Transferase (cytosolic) |
| 1 | 326 | InterPro | IPR040079 | Glutathione transferase family |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GYT0
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02883
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 0VS RCSB PDB | P42620 | 477.5 Da LogP -0.05 TPSA 193.0 | ✓ Ro5 | Alert |
CC1=C(C(=O)c2ccccc2C1=O)SC[C@@H](C(=O)NCC(=O)O)…
|
|
| GSH RCSB PDB | A0A3F2YM27 | 307.3 Da LogP -2.21 TPSA 158.8 | 1 viol. | ✓ Clean |
C(CC(=O)N[C@@H](CS)C(=O)NCC(=O)O)[C@@H](C(=O)O)N
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC3830891 ZINC | 1.000 | 307.3 Da LogP -2.21 TPSA 158.8 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CS)C(=O)NCC(=O)O)C(=O)O
|
| ZINC3830892 ZINC | 1.000 | 307.3 Da LogP -2.21 TPSA 158.8 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CS)C(=O)NCC(=O)O)C(=O)O
|
| ZINC3830893 ZINC | 1.000 | 307.3 Da LogP -2.21 TPSA 158.8 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CS)C(=O)NCC(=O)O)C(=O)O
|
| ZINC3830894 ZINC | 1.000 | 307.3 Da LogP -2.21 TPSA 158.8 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CS)C(=O)NCC(=O)O)C(=O)O
|
| ZINC5828410 ZINC | 0.821 | 306.3 Da LogP -2.81 TPSA 164.6 | 1 viol. | ✓ Clean |
NC(=O)CNC(=O)[C@H](CS)NC(=O)CC[C@H](N)C(=O)O
|
| ZINC13549503 ZINC | 0.780 | 321.4 Da LogP -2.12 TPSA 147.8 | ✓ Ro5 | ✓ Clean |
COC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(=O)O
|
| ZINC4096455 ZINC | 0.775 | 321.4 Da LogP -1.82 TPSA 158.8 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CS)C(=O)NCCC(=O)O)C(=O)O
|
| ZINC2554974 ZINC | 0.750 | 289.3 Da LogP -1.73 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC3870040 ZINC | 0.750 | 250.3 Da LogP -1.32 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CS)C(=O)O)C(=O)O
|
| ZINC3870041 ZINC | 0.750 | 250.3 Da LogP -1.32 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CS)C(=O)O)C(=O)O
|
| ZINC3870042 ZINC | 0.750 | 250.3 Da LogP -1.32 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CS)C(=O)O)C(=O)O
|
| ZINC3870043 ZINC | 0.750 | 250.3 Da LogP -1.32 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CS)C(=O)O)C(=O)O
|
| ZINC3778474 ZINC | 0.727 | 349.4 Da LogP -1.34 TPSA 147.8 | ✓ Ro5 | ✓ Clean |
CC(C)OC(=O)CNC(=O)[C@H](CS)NC(=O)CC[C@H](N)C(=O…
|
| ZINC3778476 ZINC | 0.727 | 335.4 Da LogP -1.73 TPSA 147.8 | ✓ Ro5 | ✓ Clean |
CCOC(=O)CNC(=O)[C@H](CS)NC(=O)CC[C@H](N)C(=O)O
|
| ZINC5497203 ZINC | 0.727 | 335.4 Da LogP -1.73 TPSA 147.8 | ✓ Ro5 | ✓ Clean |
CCOC(=O)CNC(=O)[C@@H](CS)NC(=O)CC[C@H](N)C(=O)O
|
| ZINC5497237 ZINC | 0.727 | 335.4 Da LogP -1.73 TPSA 147.8 | ✓ Ro5 | ✓ Clean |
CCOC(=O)CNC(=O)[C@@H](CS)NC(=O)CC[C@@H](N)C(=O)O
|
| ZINC5497239 ZINC | 0.727 | 335.4 Da LogP -1.73 TPSA 147.8 | ✓ Ro5 | ✓ Clean |
CCOC(=O)CNC(=O)[C@H](CS)NC(=O)CC[C@@H](N)C(=O)O
|
| ZINC1532230 ZINC | 0.714 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4556979 ZINC | 0.714 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4556980 ZINC | 0.714 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4556981 ZINC | 0.714 | 321.4 Da LogP -1.77 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CSC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC1616624 ZINC | 0.698 | 355.3 Da LogP -3.25 TPSA 213.2 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CS(=O)(=O)O)C(=O)NCC(=O)…
|
| ZINC1616625 ZINC | 0.698 | 355.3 Da LogP -3.25 TPSA 213.2 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CS(=O)(=O)O)C(=O)NCC(=O)O…
|
| ZINC1616626 ZINC | 0.698 | 355.3 Da LogP -3.25 TPSA 213.2 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CS(=O)(=O)O)C(=O)NCC(=O)O…
|
| ZINC1616627 ZINC | 0.698 | 355.3 Da LogP -3.25 TPSA 213.2 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CS(=O)(=O)O)C(=O)NCC(=O)O)…
|
| ZINC12496578 ZINC | 0.675 | 275.3 Da LogP -2.12 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC13522300 ZINC | 0.667 | 349.4 Da LogP -1.86 TPSA 175.9 | ✓ Ro5 | ✓ Clean |
CC(=O)SC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=…
|
| ZINC31350707 ZINC | 0.667 | 349.4 Da LogP -1.86 TPSA 175.9 | ✓ Ro5 | ✓ Clean |
CC(=O)SC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC…
|
| ZINC31350710 ZINC | 0.667 | 349.4 Da LogP -1.86 TPSA 175.9 | ✓ Ro5 | ✓ Clean |
CC(=O)SC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(…
|
| ZINC31350713 ZINC | 0.667 | 349.4 Da LogP -1.86 TPSA 175.9 | ✓ Ro5 | ✓ Clean |
CC(=O)SC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(…
|
| ZINC3872731 ZINC | 0.667 | 336.3 Da LogP -1.72 TPSA 188.2 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CSN=O)C(=O)NCC(=O)O)C(=O…
|
| ZINC3872732 ZINC | 0.667 | 336.3 Da LogP -1.72 TPSA 188.2 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCC(=O)N[C@H](CSN=O)C(=O)NCC(=O)O)C(=O)O
|
| ZINC3872733 ZINC | 0.667 | 336.3 Da LogP -1.72 TPSA 188.2 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CSN=O)C(=O)NCC(=O)O)C(=O)O
|
| ZINC3872734 ZINC | 0.667 | 336.3 Da LogP -1.72 TPSA 188.2 | ✓ Ro5 | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CSN=O)C(=O)NCC(=O)O)C(=O)O
|
| ZINC4544082 ZINC | 0.667 | 335.4 Da LogP -1.38 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCSC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4544083 ZINC | 0.667 | 335.4 Da LogP -1.38 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCSC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4544084 ZINC | 0.667 | 335.4 Da LogP -1.38 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCSC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4544085 ZINC | 0.667 | 335.4 Da LogP -1.38 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CCSC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC13451235 ZINC | 0.652 | 423.4 Da LogP -2.47 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CS[C@H](CC(=O)O)C(=O)O)C…
|
| ZINC145953214 ZINC | 0.652 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](O)CSC[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O…
|
| ZINC145953600 ZINC | 0.652 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](O)CSC[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)…
|
| ZINC14966489 ZINC | 0.652 | 423.4 Da LogP -2.47 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CS[C@@H](CC(=O)O)C(=O)O)C…
|
| ZINC14966492 ZINC | 0.652 | 423.4 Da LogP -2.47 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CS[C@@H](CC(=O)O)C(=O)O)C(…
|
| ZINC201224060 ZINC | 0.652 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](O)CSC[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)…
|
| ZINC253638410 ZINC | 0.652 | 423.4 Da LogP -2.47 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@H](CS[C@H](CC(=O)O)C(=O)O)C(=…
|
| ZINC253638411 ZINC | 0.652 | 423.4 Da LogP -2.47 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@H](CCC(=O)N[C@@H](CS[C@H](CC(=O)O)C(=O)O)C(…
|
| ZINC3920510 ZINC | 0.652 | 423.4 Da LogP -2.47 TPSA 233.4 | 1 viol. | ✓ Clean |
N[C@@H](CCC(=O)N[C@@H](CS[C@@H](CC(=O)O)C(=O)O)…
|
| ZINC77300920 ZINC | 0.652 | 365.4 Da LogP -2.02 TPSA 179.0 | 1 viol. | ✓ Clean |
C[C@H](O)CSC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)N…
|
| ZINC13507523 ZINC | 0.643 | 303.3 Da LogP -1.48 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
CC(C)[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)NCC(=O)O
|
| ZINC4899752 ZINC | 0.641 | 235.3 Da LogP -2.44 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
NCC(=O)N[C@@H](CS)C(=O)NCC(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.