KpKP13 Protein target profile

Ribosomal RNA large subunit methyltransferase G

Accession: KP13_02864

Gene: rlmG AHE42567.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GXW1
Length 376
Pocket druggability (P2Rank · AlphaFold DB model) 0.937
Functional annotation 1 EC 8 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
2.1% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
94.92 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.937
Structure A0A0H3GXW1
Pocket Pocket 1
Druggability (FPocket) 0.765
Structure A0A0H3GXW1
Pocket Pocket 13
ColabFold model
P2Rank 0.95 · Pocket 1
FPocket 0.91 · Pocket 1
Core conservation Accessory gene
Roary core
CoreCruncher accessory
Gut microbiome 101 / 4744 genomes with a hit
Prevalence 2.1%

Sequence

Primary amino-acid sequence viewer.

MSQAELNGELFTLERFPPNAEEEALQAWEAADEYLLQQVNDVDGLTLIFNDGFGALSCALAERNPVSINDSFISELATRHNLRMNGIDEESVRFQDSLSPLPAAPALVLIKVPKQLALLEQQLRALREVVTPETRIIAAAKARDVHNSTLALFEKILGTTTTSLAWKKARLIHCVFTAPKLADAPQTYSWKLDGTPWTIHNHANVFARSGLDIGARFFLQHLPSDLEGEIADLGCGNGVIGLQALAQNPNASVMFTDESHMAVASSRLNVERNLPDDIARCEFMVNNSLSGIEPDRFTAILCNPPFHQQHAITDHIAWQMFNDARRSLKYGGELYVVGNRHLDYFRKLKRAFGNCTTIATNNKFVILKATKVRKQR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 8 GO

Subcellular localization

Localization
Cytoplasmic

Enzyme Commission (EC)

1

Gene Ontology (GO)

8
  • GO:0031167 The posttranscriptional addition of methyl groups to specific residues in an rRNA molecule.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0003676 Binding to a nucleic acid.
  • GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
  • GO:0008990 Catalysis of the reaction: S-adenosyl-L-methionine + rRNA = S-adenosyl-L-homocysteine + rRNA containing N2-methylguanine.
  • GO:0032259 The process in which a methyl group is covalently attached to a molecule.
  • GO:0008757 Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a substrate.
  • GO:0052916 Catalysis of the reaction: S-adenosyl-L-methionine + guanosine(1835) in 23S rRNA = N(2)-methylguanosine(1835) in 23S rRNA + S-adenosyl-L-homocysteine.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
1 372 PIRSF PIRSF037565 RRNA_m2G_Mtase_RsmD
1 372 InterPro IPR017237 rRNA (guanine-N2-)-methyltransferase, RlmG
300 306 ProSitePatterns PS00092 N-6 Adenine-specific DNA methylases signature.
300 306 InterPro IPR002052 DNA methylase, N-6 adenine-specific, conserved site
181 376 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
181 376 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
230 337 CDD cd02440 AdoMet_MTases
181 375 FunFam G3DSA:3.40.50.150:FF:000046 Ribosomal RNA large subunit methyltransferase G
197 368 Pfam PF05175 Methyltransferase small domain
197 368 InterPro IPR007848 Methyltransferase small domain
28 371 PANTHER PTHR47816 RIBOSOMAL RNA SMALL SUBUNIT METHYLTRANSFERASE C
28 371 InterPro IPR046977 rRNA (guanine-N(2)-)-methyltransferase RsmC/RlmG
9 179 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
9 179 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
191 369 SUPERFAMILY SSF53335 S-adenosyl-L-methionine-dependent methyltransferases
191 369 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
1 371 Hamap MF_01859 Ribosomal RNA large subunit methyltransferase G [rlmG].
1 371 InterPro IPR017237 rRNA (guanine-N2-)-methyltransferase, RlmG

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.937
Likely same site as FPocket 13 3.4 Å 37 shared residues 80% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.218
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #13
0.765 Unusual size
Likely same site as P2Rank 1 3.4 Å 37 shared residues 80% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GXW1
AlphaFold DB full sequence Viewing
ColabFold KP13_02864
ColabFold full sequence Loaded

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.