Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- No hit
- Gut microbiome similarity
- 4.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Structure confidence
- ColabFold pLDDT
- 95.43 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MADLDDIKEGKDFGIDRPQQNTLYTLKGCGSLDWGMQSRLARIFNPHSNRTVMLAFDHGYFQGPTTGLERIDLSIAPLFADTDVLMCTRGVLRSQVPAATNKPVVLRASGGNSILSELSNECVAVAMEDALRLNVCAVAAQVYIGSEYEHQSINNIIKLVDSGNRYGMPVLAVTGVGKEMTRDARYFSLASRIAAEMGAQFVKTYFVEEGFEKVTASCPVPIVIAGGKKLPEHEALEMCWRAIDQGASGVDMGRNIFQSSAPRAMLKAVKKVVHENLNAREAYQFWQEEKQGELK
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Gene Ontology (GO)
2- GO:0004332 Catalysis of the reaction: beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.
- GO:0016829 Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 51 | 259 | SMART | SM01133 | DeoC_2 |
| 51 | 259 | InterPro | IPR002915 | DeoC/FbaB/LacD aldolase |
| 35 | 275 | SUPERFAMILY | SSF51569 | Aldolase |
| 51 | 274 | CDD | cd00958 | DhnA |
| 51 | 274 | InterPro | IPR041720 | Aldolase FbaB-like, archaeal-type |
| 1 | 291 | Gene3D | G3DSA:3.20.20.70 | Aldolase class I |
| 1 | 291 | InterPro | IPR013785 | Aldolase-type TIM barrel |
| 32 | 287 | PANTHER | PTHR47916 | FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS 1 |
| 31 | 289 | PIRSF | PIRSF038992 | Aldolase_Ia |
| 31 | 289 | InterPro | IPR041720 | Aldolase FbaB-like, archaeal-type |
| 51 | 259 | Pfam | PF01791 | DeoC/LacD family aldolase |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3H3A9
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02856
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 13P RCSB PDB | Q57843 | 170.1 Da LogP -1.34 TPSA 104.1 | ✓ Ro5 | ✓ Clean |
C(C(=O)COP(=O)(O)O)O
|
|
| 26T RCSB PDB | P76143 | 212.1 Da LogP -1.39 TPSA 121.1 | ✓ Ro5 | ✓ Clean |
CC(=O)[C@H](C(=O)COP(=O)(O)O)O
|
|
| 5RP RCSB PDB | P76143 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
C([C@H]([C@H](C(=O)CO)O)O)OP(=O)(O)O
|
|
| F2P RCSB PDB | Q57843 | 342.1 Da LogP -3.35 TPSA 214.4 | 1 viol. | ✓ Clean |
C([C@H]([C@H]([C@H]([C@H](COP(=O)(O)O)O)O)O)O)O…
|
|
| M2P RCSB PDB | P58315 | 342.1 Da LogP -3.35 TPSA 214.4 | 1 viol. | ✓ Clean |
C([C@H]([C@H]([C@@H]([C@@H](COP(=O)(O)O)O)O)O)O…
|
|
| R5P RCSB PDB | P76143 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
C(C(C(C(C=O)O)O)O)OP(=O)(O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC2516111 ZINC | 0.826 | 262.2 Da LogP -3.47 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)CO
|
| ZINC2522704 ZINC | 0.826 | 262.2 Da LogP -3.47 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)CO
|
| ZINC3869812 ZINC | 0.826 | 262.2 Da LogP -3.47 TPSA 167.9 | 1 viol. | ✓ Clean |
O=P(O)(O)OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO
|
| ZINC100033330 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC100067275 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC100889630 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC104861723 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)COP(=O)(O…
|
| ZINC12501558 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@H](O)[C@@H](O)COP(=O)(…
|
| ZINC12501560 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@H](O)[C@H](O)COP(=O)(O…
|
| ZINC12501562 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)COP(=O)…
|
| ZINC12501564 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@H](O)COP(=O)(…
|
| ZINC12503760 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC12503763 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC1532623 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@H](O)[C@H](O)COP(=O)(…
|
| ZINC19850142 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC2047359 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)COP(=O…
|
| ZINC2508229 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC2545091 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)COP(=O…
|
| ZINC3869602 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)COP(=…
|
| ZINC3869603 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)COP(=O…
|
| ZINC3869604 ZINC | 0.731 | 276.1 Da LogP -3.38 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)COP(=O)…
|
| ZINC4545927 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)COP(=O)(…
|
| ZINC4545928 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)COP(=O)(O…
|
| ZINC4545929 ZINC | 0.731 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)COP(=O)(O…
|
| ZINC100657408 ZINC | 0.704 | 259.2 Da LogP -3.30 TPSA 170.5 | 1 viol. | ✓ Clean |
N[C@H](C=O)[C@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC215934438 ZINC | 0.704 | 259.2 Da LogP -3.30 TPSA 170.5 | 1 viol. | ✓ Clean |
N[C@H](C=O)[C@H](O)[C@@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC255961849 ZINC | 0.704 | 259.2 Da LogP -3.30 TPSA 170.5 | 1 viol. | ✓ Clean |
N[C@H](C=O)[C@H](O)[C@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC255961850 ZINC | 0.704 | 259.2 Da LogP -3.30 TPSA 170.5 | 1 viol. | ✓ Clean |
N[C@H](C=O)[C@H](O)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC5132021 ZINC | 0.704 | 259.2 Da LogP -3.30 TPSA 170.5 | 1 viol. | ✓ Clean |
N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC1530556 ZINC | 0.692 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C[C@H](O)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC22116391 ZINC | 0.692 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC3606137 ZINC | 0.692 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C[C@@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC3869426 ZINC | 0.692 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC8551307 ZINC | 0.692 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC8551308 ZINC | 0.692 | 230.1 Da LogP -2.62 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C[C@H](O)[C@@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC5132038 ZINC | 0.679 | 290.2 Da LogP -3.90 TPSA 185.0 | 1 viol. | ✓ Clean |
O=C(CO)[C@@H](O)[C@H](O)[C@H](O)[C@H](O)COP(=O)…
|
| ZINC25721582 ZINC | 0.667 | 244.1 Da LogP -2.23 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=CC[C@H](O)[C@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC25721586 ZINC | 0.667 | 244.1 Da LogP -2.23 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=CC[C@H](O)[C@@H](O)[C@@H](O)COP(=O)(O)O
|
| ZINC4544030 ZINC | 0.667 | 244.1 Da LogP -2.23 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=CC[C@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC4544032 ZINC | 0.667 | 244.1 Da LogP -2.23 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=CC[C@@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC4544034 ZINC | 0.667 | 244.1 Da LogP -2.23 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=CC[C@H](O)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC4887586 ZINC | 0.667 | 260.1 Da LogP -2.35 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(O)C[C@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC4887587 ZINC | 0.667 | 260.1 Da LogP -2.35 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(O)C[C@@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC4887588 ZINC | 0.667 | 260.1 Da LogP -2.35 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(O)C[C@H](O)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC4887589 ZINC | 0.667 | 260.1 Da LogP -2.35 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(O)C[C@@H](O)[C@@H](O)[C@H](O)COP(=O)(O)O
|
| ZINC5975509 ZINC | 0.667 | 202.1 Da LogP -2.19 TPSA 127.5 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@H](O)[C@H](O)CO
|
| ZINC12502214 ZINC | 0.643 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@H](O)[C@@H](O)[C@@H](O)COP(=…
|
| ZINC4523251 ZINC | 0.643 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@@H](O)[C@@H](O)[C@@H](O)COP(…
|
| ZINC4523255 ZINC | 0.643 | 340.1 Da LogP -3.14 TPSA 211.3 | 1 viol. | ✓ Clean |
O=C(COP(=O)(O)O)[C@@H](O)[C@@H](O)[C@H](O)COP(=…
|
| ZINC85994845 ZINC | 0.643 | 260.1 Da LogP -3.26 TPSA 164.8 | 1 viol. | ✓ Clean |
O=C(CO)[C@@H](O)[C@H](O)[C@H](O)COP(=O)(O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.