Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 44.131 Lower values reduce human off-target concern.
- Human E-value
- 2.07e-45
- Gut microbiome similarity
- 3.0% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- N
- DEG identity (%)
- 0.0 Higher values support similarity to known essential genes.
Localization
- Localization
- CytoplasmicMembrane
Structure confidence
- ColabFold pLDDT
- 96.01 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelThe selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.
Sequence
Sequence
Primary amino-acid sequence viewer.
MNQTSTLTGQCVAEFLGTGLLIFFGAGCVAALRVAGASFGQWEISIIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFERRKVLPFIVAQTAGAFCAAALVYGLYRQLFLDLEQSQHIVRGTAASLNLAGVFSTYPHPHITFIQAFAVETTITAILMAMIMALTDDGNGIPRGPLAPLLIGLLIAVIGASMGPLTGFALNPARDFGPKLFTSLAGWGSIAFTGGLAIPYFLVPLLAPVVGAIIGAFLYRKLIGRHLPCECGIDE
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
5- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0015267 Enables the energy-independent facilitated diffusion of a solute through a transmembrane aqueous pore or channel. Stereospecificity is not exhibited but this transport may be specific for a particular molecular species or class of molecules.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0015254 Enables the energy-independent facilitated diffusion of glycerol through a transmembrane aqueous pore or channel.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 203 | 221 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 178 | 200 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 10 | 254 | CDD | cd00333 | MIP |
| 10 | 254 | InterPro | IPR000425 | Major intrinsic protein |
| 80 | 85 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 13 | 251 | NCBIfam | TIGR00861 | MIP family channel protein |
| 13 | 251 | InterPro | IPR000425 | Major intrinsic protein |
| 1 | 259 | Gene3D | G3DSA:1.20.1080.10 | Glycerol uptake facilitator protein. |
| 1 | 259 | InterPro | IPR023271 | Aquaporin-like |
| 229 | 251 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 222 | 251 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 178 | 202 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 167 | 177 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 66 | 74 | ProSitePatterns | PS00221 | MIP family signature. |
| 66 | 74 | InterPro | IPR022357 | Major intrinsic protein, conserved site |
| 143 | 165 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 12 | 34 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 44 | 66 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 46 | 79 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 12 | 34 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 9 | 28 | PRINTS | PR00783 | Major intrinsic protein family signature |
| 9 | 28 | InterPro | IPR000425 | Major intrinsic protein |
| 234 | 254 | PRINTS | PR00783 | Major intrinsic protein family signature |
| 234 | 254 | InterPro | IPR000425 | Major intrinsic protein |
| 151 | 169 | PRINTS | PR00783 | Major intrinsic protein family signature |
| 151 | 169 | InterPro | IPR000425 | Major intrinsic protein |
| 48 | 72 | PRINTS | PR00783 | Major intrinsic protein family signature |
| 48 | 72 | InterPro | IPR000425 | Major intrinsic protein |
| 184 | 206 | PRINTS | PR00783 | Major intrinsic protein family signature |
| 184 | 206 | InterPro | IPR000425 | Major intrinsic protein |
| 85 | 104 | PRINTS | PR00783 | Major intrinsic protein family signature |
| 85 | 104 | InterPro | IPR000425 | Major intrinsic protein |
| 1 | 11 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 35 | 45 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 86 | 108 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 252 | 267 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 3 | 251 | Pfam | PF00230 | Major intrinsic protein |
| 3 | 251 | InterPro | IPR000425 | Major intrinsic protein |
| 145 | 166 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 86 | 108 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 109 | 144 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 8 | 257 | SUPERFAMILY | SSF81338 | Aquaporin-like |
| 8 | 257 | InterPro | IPR023271 | Aquaporin-like |
| 7 | 260 | PANTHER | PTHR43829 | AQUAPORIN OR AQUAGLYCEROPORIN RELATED |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Binding pockets · P2Rank
Probability: high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GVU6
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_32254
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 3PE RCSB PDB | Q6J8I9 | 748.1 Da LogP 12.06 TPSA 134.4 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCN)OC…
|
|
| PS6 RCSB PDB | P55064 | 567.7 Da LogP 5.27 TPSA 171.7 | 2 viol. | ✓ Clean |
CCCCCCCCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OC[C@H…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AZM ChEMBL | P55088 | — | 222.3 Da LogP -0.86 TPSA 115.0 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1nnc(s1)S(=O)(=O)N
|
| CHEMBL121 ChEMBL | P41181 | — | 357.4 Da LogP 2.49 TPSA 71.5 | ✓ Ro5 | ✓ Clean |
CN(CCOc1ccc(CC2SC(=O)NC2=O)cc1)c1ccccn1
|
| CHEMBL128 ChEMBL | P55088 | — | 295.4 Da LogP 1.32 TPSA 65.2 | ✓ Ro5 | ✓ Clean |
CNS(=O)(=O)Cc1ccc2[nH]cc(CCN(C)C)c2c1
|
| CHEMBL16 ChEMBL | P55088 | — | 252.3 Da LogP 1.77 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)C(c2ccccc2)(c2ccccc2)N1
|
| CHEMBL536151 ChEMBL | P55087 | — | 383.7 Da LogP 5.34 TPSA 49.3 | 1 viol. | ✓ Clean |
O=C(Nc1cc(C(F)(F)F)cc(C(F)(F)F)c1)c1cc(Cl)ccc1O
|
| CHEMBL687 ChEMBL | P55088 | — | 214.2 Da LogP 0.29 TPSA 89.3 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc(S(N)(=O)=O)cc1
|
| CHEMBL741 ChEMBL | P55088 | — | 256.1 Da LogP 2.01 TPSA 90.7 | ✓ Ro5 | ✓ Clean |
Nc1nnc(-c2cccc(Cl)c2Cl)c(N)n1
|
| EZL ChEMBL | P55088 | — | 258.3 Da LogP 1.34 TPSA 82.3 | ✓ Ro5 | ✓ Clean |
CCOc1ccc2c(c1)sc(n2)S(=O)(=O)N
|
| FOK ChEMBL | P41181 | — | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
CC(=O)O[C@H]1[C@H]([C@H]2C(CC[C@@H]([C@@]2([C@@…
|
| TOR ChEMBL | P55088 | — | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(O[C@@H]2CO[C@@]3([C@H]([C@@H]2O1)OC(O3)(C)C…
|
| ZON ChEMBL | P55087 | — | 212.2 Da LogP 0.62 TPSA 86.2 | ✓ Ro5 | ✓ Clean |
c1ccc2c(c1)c(no2)CS(=O)(=O)N
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC102190506 ZINC | 1.000 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@H](CO[P@@](=O)(O)OCCN)OC(=O)CC…
|
| ZINC102190512 ZINC | 1.000 | 467.5 Da LogP 4.25 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)C…
|
| ZINC13156 ZINC | 1.000 | 256.1 Da LogP 2.01 TPSA 90.7 | ✓ Ro5 | ✓ Clean |
Nc1nnc(-c2cccc(Cl)c2Cl)c(N)n1
|
| ZINC134036 ZINC | 1.000 | 214.2 Da LogP 0.29 TPSA 89.3 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc(S(N)(=O)=O)cc1
|
| ZINC13612334 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@H]2CO[C@]3(COS(N)(=O)=O)OC(C)(C)O[C@@…
|
| ZINC13783471 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@]1(C)CC(=O)[C@]2(O)[C@](C)(O1)[C@H](OC(C)…
|
| ZINC13783493 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@@H]2CO[C@]3(COS(N)(=O)=O)OC(C)(C)O[C@…
|
| ZINC14360 ZINC | 1.000 | 295.4 Da LogP 1.32 TPSA 65.2 | ✓ Ro5 | ✓ Clean |
CNS(=O)(=O)Cc1ccc2[nH]cc(CCN(C)C)c2c1
|
| ZINC144827766 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@@](C)(O1)[C@@H](O…
|
| ZINC1543366 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@H]2CO[C@@]3(COS(N)(=O)=O)OC(C)(C)O[C@…
|
| ZINC23586802 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@H]2CO[C@@]3(COS(N)(=O)=O)OC(C)(C)O[C@…
|
| ZINC248102933 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@]1(C)CC(=O)[C@@]2(O)[C@]3(C)[C@@H](O)CCC(…
|
| ZINC248102936 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@]1(C)CC(=O)[C@@]2(O)[C@]3(C)[C@H](O)CCC(C…
|
| ZINC2510358 ZINC | 1.000 | 252.3 Da LogP 1.77 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)C(c2ccccc2)(c2ccccc2)N1
|
| ZINC36385190 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@]1(C)CC(=O)[C@]2(O)[C@](C)(O1)[C@H](OC(C)…
|
| ZINC3813042 ZINC | 1.000 | 222.3 Da LogP -0.86 TPSA 115.0 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1nnc(S(N)(=O)=O)s1
|
| ZINC3831557 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@@H]2CO[C@@]3(COS(N)(=O)=O)OC(C)(C)O[C…
|
| ZINC3831559 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@@H]2CO[C@]3(COS(N)(=O)=O)OC(C)(C)O[C@…
|
| ZINC3872620 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@](C)(O1)[C@H](OC(…
|
| ZINC3872621 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@](C)(O1)[C@@H](OC…
|
| ZINC3872622 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@](C)(O1)[C@H](OC(…
|
| ZINC3872623 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@](C)(O1)[C@@H](OC…
|
| ZINC3977779 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@](C)(O1)[C@@H](OC…
|
| ZINC4321 ZINC | 1.000 | 212.2 Da LogP 0.62 TPSA 86.2 | ✓ Ro5 | ✓ Clean |
NS(=O)(=O)Cc1noc2ccccc12
|
| ZINC43574047 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@@H]2[C@@H]3OC(C)(C)O[C@@]3(COS(N)(=O)…
|
| ZINC4544736 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@]1(C)CC(=O)[C@]2(O)[C@@](C)(O1)[C@H](OC(C…
|
| ZINC56721 ZINC | 1.000 | 258.3 Da LogP 1.34 TPSA 82.3 | ✓ Ro5 | ✓ Clean |
CCOc1ccc2nc(S(N)(=O)=O)sc2c1
|
| ZINC56863626 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@H]2[C@@H](CO[C@]3(COS(N)(=O)=O)OC(C)(…
|
| ZINC71789673 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@]2(O)[C@](C)(O1)[C@@H](OC(…
|
| ZINC71789674 ZINC | 1.000 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@]2(O)[C@](C)(O1)[C@@H](OC(…
|
| ZINC95616603 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@@H]2CO[C@@]3(COS(N)(=O)=O)OC(C)(C)O[C…
|
| ZINC96085732 ZINC | 1.000 | 339.4 Da LogP -0.40 TPSA 115.5 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@@H]2[C@@H]3OC(C)(C)O[C@]3(COS(N)(=O)=…
|
| ZINC968328 ZINC | 1.000 | 357.4 Da LogP 2.49 TPSA 71.5 | ✓ Ro5 | ✓ Clean |
CN(CCOc1ccc(C[C@@H]2SC(=O)NC2=O)cc1)c1ccccn1
|
| ZINC968330 ZINC | 1.000 | 357.4 Da LogP 2.49 TPSA 71.5 | ✓ Ro5 | ✓ Clean |
CN(CCOc1ccc(C[C@H]2SC(=O)NC2=O)cc1)c1ccccn1
|
| ZINC27416437 ZINC | 0.976 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@H](CO[P@](=O)(O)OCCN)OC(=O)CCCCC
|
| ZINC33902364 ZINC | 0.976 | 411.4 Da LogP 2.69 TPSA 134.4 | ✓ Ro5 | ✓ Clean |
CCCCCC(=O)OC[C@@H](CO[P@@](=O)(O)OCCN)OC(=O)CCC…
|
| ZINC12970899 ZINC | 0.889 | 290.3 Da LogP 1.96 TPSA 89.3 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc(-c2ccc(S(N)(=O)=O)cc2)cc1
|
| ZINC2382316250 ZINC | 0.887 | 452.5 Da LogP 2.09 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@]2(O)[C@](C)(O1)[C@@H](OC(…
|
| ZINC27553862 ZINC | 0.887 | 452.5 Da LogP 2.09 TPSA 119.4 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@](C)(O1)[C@@H](OC…
|
| ZINC13111092 ZINC | 0.852 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@](C)(O1)[C@@H](O)…
|
| ZINC2069563917 ZINC | 0.852 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@]2(O)[C@](C)(O1)[C@@H](O)[…
|
| ZINC71766833 ZINC | 0.852 | 410.5 Da LogP 1.52 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
C=C[C@@]1(C)CC(=O)[C@@]2(O)[C@](C)(O1)[C@@H](O)…
|
| ZINC6116337 ZINC | 0.815 | 270.3 Da LogP 1.91 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)[C@](c2ccccc2)(c2ccc(F)cc2)N1
|
| ZINC6116537 ZINC | 0.815 | 270.3 Da LogP 1.91 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)[C@@](c2ccccc2)(c2ccc(F)cc2)N1
|
| ZINC2165131 ZINC | 0.800 | 369.4 Da LogP 1.09 TPSA 135.4 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc(S(=O)(=O)Nc2ccc(S(N)(=O)=O)cc2)cc1
|
| ZINC242063 ZINC | 0.800 | 333.4 Da LogP 1.54 TPSA 118.4 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc(C(=O)Nc2ccc(S(N)(=O)=O)cc2)cc1
|
| ZINC114897182 ZINC | 0.788 | 495.7 Da LogP 3.50 TPSA 84.2 | ✓ Ro5 | Alert |
CNS(=O)(=O)Cc1ccc2[nH]c(Cc3ccc4[nH]cc(CCN(C)C)c…
|
| ZINC22061272 ZINC | 0.787 | 355.4 Da LogP -1.42 TPSA 135.8 | ✓ Ro5 | ✓ Clean |
CC1(C)O[C@H]2[C@@H]3O[C@](C)(CO)O[C@@H]3CO[C@@]…
|
| ZINC119642 ZINC | 0.786 | 268.3 Da LogP 1.48 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)[C@](c2ccccc2)(c2ccc(O)cc2)N1
|
| ZINC2048546 ZINC | 0.786 | 286.7 Da LogP 2.42 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)[C@](c2ccccc2)(c2ccc(Cl)cc2)N1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.