KpKP13 Protein target profile

G/U mismatch-specific DNA glycosylase

Accession: KP13_02827

Gene: mug AHE42604.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GTH2
Length 168
Pocket druggability (P2Rank · AlphaFold DB model) 0.819
Direct ligand evidence 0 16 total records
Functional annotation 1 EC 6 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
47.5 Lower values reduce human off-target concern.
Human E-value
6.66e-07
Gut microbiome similarity
1.7% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.06 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.819
Structure A0A0H3GTH2
Pocket Pocket 1
Druggability (FPocket) 0.868
Structure A0A0H3GTH2
Pocket Pocket 1
ColabFold model
P2Rank 0.825 · Pocket 1
FPocket 0.836 · Pocket 9
Core conservation Conserved core gene
Roary core
CoreCruncher core
Gut microbiome 80 / 4744 genomes with a hit
Prevalence 1.7%

Sequence

Primary amino-acid sequence viewer.

MISDILAPGLRVVFCGINPGKSSAHTGFHFAHPGNRFWKVIHQAGFTDRQLRPEEELQLLDTRCGITMLVERPTVQASEVALQELRSGGRELVRKIEEYQPQALAVLGKQAFELAFNQRGAKWGKQAMTIGTTQVWVLPNPSGLNRATLDKLVAAYRELDDALATRGQ

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Subcellular localization

Localization
Unknown

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0006285 The formation of an AP site, a deoxyribose sugar with a missing base, by DNA glycosylase which recognizes an altered base in DNA and catalyzes its hydrolytic removal. This sugar phosphate is the substrate recognized by the AP endonuclease, which cuts the DNA phosphodiester backbone at the 5' side of the altered site to leave a gap which is subsequently repaired.
  • GO:0000700 Catalysis of the removal of single bases present in mismatches by the cleavage the N-C1' glycosidic bond between the target damaged DNA base and the deoxyribose sugar. The reaction releases a free base and leaves an apurinic/apyrimidinic (AP) site.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0008263 Catalysis of the removal of mismatched pyrimidine bases in DNA. Enzymes with this activity recognize and remove pyrimidines present in mismatches by cleaving the N-C1' glycosidic bond between the target damaged DNA base and the deoxyribose sugar. The reaction releases a free base and leaves an apyrimidinic (AP) site.
  • GO:0004844 Catalysis of the cleavage of the N-C1' glycosidic bond between the damaged DNA base and the deoxyribose sugar, releasing a free base and leaving an apyrimidinic (AP) site. Enzymes with this activity recognize and remove uracil bases in DNA that result from the deamination of cytosine or the misincorporation of dUTP opposite an adenine.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
3 159 SMART SM00986 UDG_2
3 159 InterPro IPR005122 Uracil-DNA glycosylase-like
3 159 SMART SM00987 UDG_2_a
2 162 PANTHER PTHR12159 G/T AND G/U MISMATCH-SPECIFIC DNA GLYCOSYLASE
2 162 InterPro IPR015637 Uracil DNA glycosylase family 2
1 168 Hamap MF_01956 G/U mismatch-specific DNA glycosylase [mug].
1 168 InterPro IPR023502 G/U mismatch-specific DNA glycosylase MUG, bacterial
1 168 Gene3D G3DSA:3.40.470.10 -
1 168 InterPro IPR036895 Uracil-DNA glycosylase-like domain superfamily
6 159 Pfam PF03167 Uracil DNA glycosylase superfamily
6 159 InterPro IPR005122 Uracil-DNA glycosylase-like
2 159 CDD cd10028 UDG-F2_TDG_MUG
2 159 InterPro IPR015637 Uracil DNA glycosylase family 2
2 161 SUPERFAMILY SSF52141 Uracil-DNA glycosylase-like
2 161 InterPro IPR036895 Uracil-DNA glycosylase-like domain superfamily

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.819
Likely same site as FPocket 1 2.5 Å 23 shared residues 96% of smaller site
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.868 Unusual size
Likely same site as P2Rank 1 2.5 Å 23 shared residues 96% of smaller site
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GTH2
AlphaFold DB full sequence Viewing
ColabFold KP13_02827
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

16 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 2 records from similar proteins
Structural ligands 2 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 14 similarity-based ZINC candidates
Best available ligand signal
1RT PDB via homolog 155.1 Da · LogP -0.95 · TPSA 109.1 Open detail RCSB PDB
HMU PDB via homolog Detail RCSB PDB
ZINC62714228 ZINC proposed compound · Tanimoto 0.613 Detail ZINC
ZINC1682039 ZINC proposed compound · Tanimoto 0.594 Detail ZINC
ZINC1615551 ZINC proposed compound · Tanimoto 0.586 Detail ZINC

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1RT RCSB PDB Q13569 155.1 Da LogP -0.95 TPSA 109.1 ✓ Ro5 ✓ Clean C1=C(C(=NC(=O)N1)N)C(=O)O
HMU RCSB PDB Q13569 142.1 Da LogP -1.44 TPSA 86.0 ✓ Ro5 ✓ Clean C1=C(C(=O)NC(=O)N1)CO

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.