Promising target candidate with multiple supporting evidence streams.
Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.
Main supporting evidence
Risks to review
Terms and data sources used on this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Prioritization evidence
Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.
Off-target risk
- Human off-target
- Hit
- Human identity (%)
- 31.606 Lower values reduce human off-target concern.
- Human E-value
- 2.82e-13
- Gut microbiome similarity
- 6.6% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.
Essentiality
- Essential (DEG)
- Y
- DEG identity (%)
- 46.0 Higher values support similarity to known essential genes.
- DEG E-value
- 1.3199999999999999e-48 Smaller values mean stronger essential-gene similarity.
Structure confidence
- ColabFold pLDDT
- 96.48 0-100 confidence; >70 supports local structural interpretation.
Binding-site evidence
AlphaFold DB / UniProt modelP2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MQKVVLATGNAGKVRELASLLEDFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQITGLPAIADDSGLAVDALGGAPGIYSARYSGVDASDQQNLEKLLDALKDVPDDQRQAQFHCVLVYLRHAEDPTPLVCHGSWPGVITRQAAGHGGFGYDPIFFVPSEGKTAAELSREEKSAISHRGQALKLLLEALRNG
Functional annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Subcellular localization
- Localization
- Cytoplasmic
Enzyme Commission (EC)
1Gene Ontology (GO)
11- GO:0009143 The chemical reactions and pathways resulting in the breakdown of a nucleoside triphosphate, a compound consisting of a nucleobase linked to a deoxyribose or ribose sugar esterified with triphosphate on the sugar.
- GO:0017111 Catalysis of the reaction: a ribonucleoside triphosphate + H2O = a ribonucleoside diphosphate + H+ + phosphate.
- GO:0047429 Catalysis of the reaction: a nucleoside triphosphate + H2O = a nucleotide + H+ + diphosphate.
- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0035870 Catalysis of the reaction: dITP + H2O = dIMP + H+ + diphosphate.
- GO:0036220 Catalysis of the reaction: ITP + H2O = IMP + H+ + diphosphate.
- GO:0046872 Binding to a metal ion.
- GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
- GO:0036222 Catalysis of the reaction: XTP + H2O = XMP + H+ + diphosphate.
- GO:0009117 The chemical reactions and pathways involving a nucleotide, a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the glycose moiety; may be mono-, di- or triphosphate; this definition includes cyclic nucleotides (nucleoside cyclic phosphates).
- GO:0009146 The chemical reactions and pathways resulting in the breakdown of purine nucleoside triphosphate, a compound consisting of a purine base linked to a ribose or deoxyribose sugar esterified with triphosphate on the sugar.
Sequence domains and features
Domain and signature matches imported from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 2 | 196 | Hamap | MF_01405 | dITP/XTP pyrophosphatase. |
| 2 | 196 | InterPro | IPR020922 | dITP/XTP pyrophosphatase |
| 1 | 195 | SUPERFAMILY | SSF52972 | ITPase-like |
| 1 | 195 | InterPro | IPR029001 | Inosine triphosphate pyrophosphatase-like |
| 1 | 197 | Gene3D | G3DSA:3.90.950.10 | - |
| 1 | 197 | InterPro | IPR029001 | Inosine triphosphate pyrophosphatase-like |
| 2 | 195 | PANTHER | PTHR11067 | INOSINE TRIPHOSPHATE PYROPHOSPHATASE/HAM1 PROTEIN |
| 2 | 195 | InterPro | IPR002637 | RdgB/HAM1 |
| 1 | 197 | FunFam | G3DSA:3.90.950.10:FF:000001 | dITP/XTP pyrophosphatase |
| 3 | 194 | NCBIfam | TIGR00042 | RdgB/HAM1 family non-canonical purine NTP pyrophosphatase |
| 3 | 194 | InterPro | IPR002637 | RdgB/HAM1 |
| 4 | 193 | CDD | cd00515 | HAM1 |
| 4 | 193 | InterPro | IPR002637 | RdgB/HAM1 |
| 4 | 192 | Pfam | PF01725 | Ham1 family |
| 4 | 192 | InterPro | IPR002637 | RdgB/HAM1 |
3D structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
How colors and pocket overlays are used
Pocket details Inspect a specific pocket, or open the full viewer
- Method
- -
- Score
- -
- Visible layer
- -
- Residues
- -
- Pocket properties
- -
Selecting a pocket opens its details and centers the viewer without clearing other active layers. Use Focus this pocket when you want to hide the rest; use Surface for the wider residue environment.
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
Residue sets
Binding pockets · P2Rank
Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2
Binding pockets · FPocket
Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4
All structural evidence
Structural evidence
0 + 2Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold DB
AF_A0A0H3GYB8
|
AlphaFold DB | — | — | full sequence | — | Viewing |
|
ColabFold
KP13_02739
|
ColabFold | — | — | full sequence | — | Loaded |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural and bioactivity evidence are both available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in Target, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| ANP RCSB PDB | Q57679 | 506.2 Da LogP -2.06 TPSA 281.9 | 3 viol. | ✓ Clean |
c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
|
|
| IMP RCSB PDB | O59580 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)(O…
|
|
| POP RCSB PDB | Q9BY32 | 176.0 Da LogP -2.08 TPSA 129.9 | ✓ Ro5 | ✓ Clean |
O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC14951284 ZINC | 1.000 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C…
|
| ZINC1532551 ZINC | 1.000 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@…
|
| ZINC16969369 ZINC | 1.000 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@…
|
| ZINC4228242 ZINC | 1.000 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@…
|
| ZINC4353761 ZINC | 1.000 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C…
|
| ZINC8614392 ZINC | 1.000 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](COP(=O)(O)O)[C…
|
| ZINC106686432 ZINC | 0.849 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP…
|
| ZINC12958393 ZINC | 0.849 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CO[P@](=O)(O)O…
|
| ZINC35024781 ZINC | 0.849 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)O…
|
| ZINC35024785 ZINC | 0.849 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)O…
|
| ZINC35024786 ZINC | 0.849 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)…
|
| ZINC4261903 ZINC | 0.849 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)O…
|
| ZINC80601236 ZINC | 0.849 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)O…
|
| ZINC95921560 ZINC | 0.849 | 428.2 Da LogP -2.03 TPSA 226.5 | 2 viol. | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO[P@@](=O)(O)O…
|
| ZINC77319466 ZINC | 0.792 | 364.3 Da LogP -0.78 TPSA 163.0 | ✓ Ro5 | ✓ Clean |
O=P(O)(O)OC[C@@H]1O[C@H](n2cnc3c(=S)[nH]cnc32)[…
|
| ZINC225456440 ZINC | 0.750 | 282.3 Da LogP -1.61 TPSA 122.5 | ✓ Ro5 | ✓ Clean |
COC[C@@H]1O[C@H](n2cnc3c(=O)[nH]cnc32)[C@H](O)[…
|
| ZINC230149202 ZINC | 0.750 | 282.3 Da LogP -1.61 TPSA 122.5 | ✓ Ro5 | ✓ Clean |
COC[C@@H]1O[C@H](n2cnc3c(=O)[nH]cnc32)[C@@H](O)…
|
| ZINC12501413 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC12958448 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC1532555 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC16546189 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC2159505 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3073318 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3869963 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@@H](O)…
|
| ZINC3869965 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@@H]2O[C@@H](COP(=O)(O)O)[C@@H](O…
|
| ZINC9334496 ZINC | 0.732 | 363.2 Da LogP -2.57 TPSA 206.0 | 1 viol. | ✓ Clean |
Nc1nc2c(ncn2[C@H]2O[C@@H](COP(=O)(O)O)[C@H](O)[…
|
| ZINC4531685 ZINC | 0.727 | 332.2 Da LogP -1.12 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1C[C@H](O)[C@H](COP(=O)…
|
| ZINC4531686 ZINC | 0.727 | 332.2 Da LogP -1.12 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1C[C@H](O)[C@H](COP(=O)(…
|
| ZINC4531687 ZINC | 0.727 | 332.2 Da LogP -1.12 TPSA 159.8 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1C[C@@H](O)[C@H](COP(=O)…
|
| ZINC33979258 ZINC | 0.714 | 364.2 Da LogP -2.45 TPSA 200.2 | 1 viol. | ✓ Clean |
O=c1[nH]c(O)nc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)…
|
| ZINC33979259 ZINC | 0.714 | 364.2 Da LogP -2.45 TPSA 200.2 | 1 viol. | ✓ Clean |
O=c1[nH]c(O)nc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)…
|
| ZINC78920152 ZINC | 0.714 | 364.2 Da LogP -2.45 TPSA 200.2 | 1 viol. | ✓ Clean |
O=c1[nH]c(O)nc2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)…
|
| ZINC8614391 ZINC | 0.709 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
O=c1nc[nH]c2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@…
|
| ZINC8614393 ZINC | 0.709 | 348.2 Da LogP -2.15 TPSA 180.0 | ✓ Ro5 | ✓ Clean |
O=c1nc[nH]c2c1ncn2[C@H]1O[C@@H](COP(=O)(O)O)[C@…
|
| ZINC16951611 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](O)[C@H…
|
| ZINC2573068 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CO)[C@H](O)[C@…
|
| ZINC4015531 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C…
|
| ZINC5106288 ZINC | 0.706 | 270.2 Da LogP -1.29 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CF)[C@@H](O)[C@…
|
| ZINC5106290 ZINC | 0.706 | 270.2 Da LogP -1.29 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CF)[C@@H](O)[C…
|
| ZINC5106293 ZINC | 0.706 | 270.2 Da LogP -1.29 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CF)[C@@H](O)[C@…
|
| ZINC5106295 ZINC | 0.706 | 270.2 Da LogP -1.29 TPSA 113.3 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CF)[C@@H](O)[C…
|
| ZINC5127789 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@H](CO)[C@@H](O)[C@H…
|
| ZINC8613160 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@@…
|
| ZINC8613161 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@H](CO)[C@H](O)[C@H…
|
| ZINC8614390 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@@H](CO)[C@@H](O)[C…
|
| ZINC8652273 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@…
|
| ZINC8652274 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO)[C@@H](O)[C@…
|
| ZINC8855117 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@@H]1O[C@H](CO)[C@@H](O)[C@…
|
| ZINC895160 ZINC | 0.706 | 268.2 Da LogP -2.27 TPSA 133.5 | ✓ Ro5 | ✓ Clean |
O=c1[nH]cnc2c1ncn2[C@H]1O[C@@H](CO)[C@H](O)[C@@…
|
| ZINC2018106 ZINC | 0.700 | 206.2 Da LogP -0.86 TPSA 132.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CC[C@](O)(CC(=O)O)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.
Cross-references
External database identifiers for this protein, its structures, ligands, and metabolic reactions.