KpKP13 Protein target profile

Rieske [2Fe-2S] iron-sulfur domain-containing protein

Accession: KP13_02716

Gene: AHE42716.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GT40
Length 340
Pocket druggability (P2Rank · AlphaFold DB model) 0.786
Direct ligand evidence 0 63 total records
Functional annotation 0 EC 4 GO
Target summary

Promising target candidate with multiple supporting evidence streams.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
No hit
Gut microbiome similarity
0.8% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
91.19 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.786
Structure A0A0H3GT40
Pocket Pocket 1
Druggability (FPocket) 0.561
Structure A0A0H3GT40
Pocket Pocket 1
ColabFold model
P2Rank 0.778 · Pocket 1
FPocket 0.747 · Pocket 2
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 38 / 4744 genomes with a hit
Prevalence 0.8%

Sequence

Primary amino-acid sequence viewer.

MTTTVQNYLDKGLRGLWYPVLASWEVQSAPVGITRLGEQIVVWRNKDGQVQALEDRCPHRGARLSMGWNLGDRIACWYHGVEVAGNGEVKDVPAVDRCPLVGQQCVRSYSVHEAHGAIFLWFGVTADQQPDELSFPEELADSEKYSNFLCTAAWKCNYQYALENVMDPMHGTYLHSSSHSMAEGDRKADMVLQPTKTGFIFEKKGQSGVNFDWVELGNSGAYWMRLSIPYKKRFGPGGHFWIVGMVVPEDNDNCRVFFWRIRGVQGWQRDLWRFMYRNRLEKLHWEVLEQDRVVLESLAPNARDHEYLYQHDVGLSRLRRMMQKAAKEQLALREAQQGAA

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

4
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0051537 Binding to a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0051213 Catalysis of the incorporation of both atoms of molecular oxygen (O2) into the substrate.
  • GO:0046872 Binding to a metal ion.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
17 127 CDD cd03469 Rieske_RO_Alpha_N
17 97 Pfam PF00355 Rieske [2Fe-2S] domain
17 97 InterPro IPR017941 Rieske [2Fe-2S] iron-sulphur domain
8 123 SUPERFAMILY SSF50022 ISP domain
8 123 InterPro IPR036922 Rieske [2Fe-2S] iron-sulphur domain superfamily
16 331 PANTHER PTHR21266 IRON-SULFUR DOMAIN CONTAINING PROTEIN
154 327 Pfam PF19112 Vanillate O-demethylase oxygenase C-terminal domain
154 327 InterPro IPR044043 Vanillate O-demethylase oxygenase-like, C-terminal catalytic domain
10 138 Gene3D G3DSA:2.102.10.10 -
10 138 InterPro IPR036922 Rieske [2Fe-2S] iron-sulphur domain superfamily
144 336 Gene3D G3DSA:3.90.380.10 -
17 120 ProSiteProfiles PS51296 Rieske [2Fe-2S] iron-sulfur domain profile.
17 120 InterPro IPR017941 Rieske [2Fe-2S] iron-sulphur domain
130 328 SUPERFAMILY SSF55961 Bet v1-like

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.786
Likely same site as FPocket 1 1.4 Å 14 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.394
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.086
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.066
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.053
Show in viewer
Surrounding area

Binding pockets · FPocket

Druggability (FPocket): high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Pocket 1 FPocket #1
0.561
Likely same site as P2Rank 1 1.4 Å 14 shared residues 100% of smaller site
Show in viewer
Surrounding area
Pocket 2 FPocket #7
0.513
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GT40
AlphaFold DB full sequence Viewing
ColabFold KP13_02716
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

63 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 13 records from similar proteins
Structural ligands 13 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 50 similarity-based ZINC candidates
Best available ligand signal
30Q PDB via homolog 457.7 Da · LogP 5.33 · TPSA 63.2 Open detail RCSB PDB
9CA PDB via homolog Detail RCSB PDB
9FL PDB via homolog Detail RCSB PDB
9G0 PDB via homolog Detail RCSB PDB
BPY PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
30Q RCSB PDB F1CMX0 457.7 Da LogP 5.33 TPSA 63.2 1 viol. ✓ Clean CCC(=O)NCCSC(=O)[C@@H](C)[C@H]1CC[C@@H]2[C@@]1(…
9CA RCSB PDB Q84II6 167.2 Da LogP 3.32 TPSA 15.8 ✓ Ro5 ✓ Clean c1ccc2c(c1)c3ccccc3[nH]2
9FL RCSB PDB Q84II6 166.2 Da LogP 3.26 TPSA 0.0 ✓ Ro5 ✓ Clean c1ccc-2c(c1)Cc3c2cccc3
9G0 RCSB PDB Q84II6 201.2 Da LogP 2.35 TPSA 66.5 ✓ Ro5 Alert c1ccc(c(c1)c2cccc(c2O)O)N
BPY RCSB PDB Q84II6 186.2 Da LogP 2.76 TPSA 40.5 ✓ Ro5 Alert c1ccc(cc1)c2cccc(c2O)O
D3M RCSB PDB Q5S3I3 221.0 Da LogP 2.70 TPSA 46.5 ✓ Ro5 ✓ Clean COc1c(ccc(c1C(=O)O)Cl)Cl
EHX RCSB PDB Q84II6 201.2 Da LogP 2.64 TPSA 41.5 ✓ Ro5 ✓ Clean c1ccc2c(c1)C3=CC=CC[C@@]3(N2)OO
FES RCSB PDB Q84II6 175.8 Da LogP 1.29 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]S[Fe]1
HXX RCSB PDB Q5S3I3 207.0 Da LogP 2.40 TPSA 57.5 ✓ Ro5 ✓ Clean c1cc(c(c(c1Cl)C(=O)O)O)Cl
MXE RCSB PDB Q84II6 76.1 Da LogP -0.37 TPSA 29.5 ✓ Ro5 ✓ Clean COCCO
OXY RCSB PDB Q84II6 32.0 Da LogP 0.07 TPSA 34.1 ✓ Ro5 ✓ Clean O=O
PG0 RCSB PDB Q84II6 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO
WBP RCSB PDB Q84II6 202.2 Da LogP 2.47 TPSA 60.7 ✓ Ro5 Alert c1ccc(c(c1)c2cccc(c2O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.