KpKP13 Protein target profile

FAD-dependent pyridine nucleotide-disulfide oxidoreductase family protein

Accession: KP13_02712

Gene: AHE42720.1 3D evidence: AlphaFold DB model + ColabFold model UniProt A0A0H3GY76
Length 398
Pocket druggability (P2Rank · AlphaFold DB model) 0.939
Direct ligand evidence 0 33 total records
Functional annotation 0 EC 4 GO
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

Automated synthesis of the evidence currently loaded. Review the underlying records before prioritizing this protein.

Terms and data sources used on this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal Target pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Prioritization evidence

Selectivity, essentiality, structural confidence, conservation, and predicted binding-site evidence.

Off-target risk

Human off-target
Hit
Human identity (%)
26.598 Lower values reduce human off-target concern.
Human E-value
1.2200000000000001e-29
Gut microbiome similarity
0.5% of screened genomes Lower prevalence suggests narrower overlap with the screened gut microbiome.

Essentiality

Essential (DEG)
N
DEG identity (%)
0.0 Higher values support similarity to known essential genes.

Structure confidence

ColabFold pLDDT
96.67 0-100 confidence; >70 supports local structural interpretation.

Binding-site evidence

AlphaFold DB / UniProt model

P2Rank's binding-site probability is the primary druggability signal shown across the app; FPocket's druggability score is shown alongside it for comparison. Both estimate small-molecule pocket quality after applying the curated structure priority — neither is experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

Druggability (P2Rank) 0.939
Structure A0A0H3GY76
Pocket Pocket 1
Druggability (FPocket) 0.109
Structure A0A0H3GY76
Pocket Pocket 1
ColabFold model
P2Rank 0.961 · Pocket 1
FPocket 0.201 · Pocket 1
Core conservation Accessory gene
Roary accessory
CoreCruncher accessory
Gut microbiome 25 / 4744 genomes with a hit
Prevalence 0.5%

Sequence

Primary amino-acid sequence viewer.

MTARIVIIGGGQAGGWAAKTLRDEGFSGEICVVAEEQWDFYERPPLSKAALLEAEPALPRLFSAEVQQALDLRWYRPLRAKSIDRQNKTLALSNGEMLAYDLLLIATGGRARLPSEAWGQHPQVYTLRHWQDAQRLKQRLASATRLAIVGGGWIGLEIAASARKSGVAVTLYEQQPALCMRSVSMEVSQALDELHRGQGVDIRRGCGALELEDDNGLPTLHCDGQRETFDAVVVGIGVDLNLELARDAGLTVDRGIIVNAQGRSNDPAIFAAGDVAQHHQYGLCIQSWAFAQNQAIATAKAMLDPQASGYDEAPWLWSDQYDRNIQILGIPQAGSRTIVRDEPQGAIYFSLNADGRLTQLVAFNNARIVKLAKRWMAAGRDLSNVPLADPTFSLMSLR

Functional annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Subcellular localization

Localization
Cytoplasmic

Gene Ontology (GO)

4
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0050660 Binding to FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0016651 Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.

Sequence domains and features

Domain and signature matches imported from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
308 397 SUPERFAMILY SSF55424 FAD/NAD-linked reductases, dimerisation (C-terminal) domain
308 397 InterPro IPR016156 FAD/NAD-linked reductase, dimerisation domain superfamily
315 397 Pfam PF14759 Reductase C-terminal
315 397 InterPro IPR028202 Reductase, C-terminal
4 26 PRINTS PR00411 Pyridine nucleotide disulphide reductase class-I signature
269 276 PRINTS PR00411 Pyridine nucleotide disulphide reductase class-I signature
230 244 PRINTS PR00411 Pyridine nucleotide disulphide reductase class-I signature
145 170 PRINTS PR00411 Pyridine nucleotide disulphide reductase class-I signature
2 303 SUPERFAMILY SSF51905 FAD/NAD(P)-binding domain
2 303 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
113 236 Gene3D G3DSA:3.50.50.60 -
113 236 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
5 295 Gene3D G3DSA:3.50.50.60 -
5 295 InterPro IPR036188 FAD/NAD(P)-binding domain superfamily
5 383 PANTHER PTHR43557 APOPTOSIS-INDUCING FACTOR 1
311 398 Gene3D G3DSA:3.30.390.30 -
311 398 InterPro IPR016156 FAD/NAD-linked reductase, dimerisation domain superfamily
254 276 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
229 245 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
100 118 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
5 24 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
145 163 PRINTS PR00368 FAD-dependent pyridine nucleotide reductase signature
4 289 Pfam PF07992 Pyridine nucleotide-disulphide oxidoreductase
4 289 InterPro IPR023753 FAD/NAD(P)-binding domain

3D structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

Download VMD script Full viewer

Loading 3D structure...

Drag to rotate — click the view, then scroll to zoom.

Pocket score High Medium Low
How colors and pocket overlays are used
Uniform protein color marks the displayed model as a single molecular object.
Experimental PDB structures may be colored by chain to distinguish subunits or copies present in the file.
Pocket colors and alpha spheres are evidence overlays for predicted binding cavities; they are not alternative protein chains.
'Alpha spheres' is FPocket's own cavity-shape geometry, imported when available and aligned with the loaded structure.
'Pocket atoms'/'Predicted site atoms' show the pocket's residue atoms instead: P2Rank reports residues rather than alpha spheres, and FPocket falls back to this when alpha-sphere geometry is unavailable or doesn't align.
'No pocket geometry' means neither alpha spheres nor residue-position data could be found for that pocket; the layer just highlights the same residues as 'Nearby residues'.
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · P2Rank

Druggability (P2Rank): high ≥ 0.5 · medium 0.2–0.49 · low < 0.2

Pocket 1 P2Rank #1
0.939
Show in viewer
Surrounding area
Pocket 2 P2Rank #2
0.618
Show in viewer
Surrounding area
Pocket 3 P2Rank #3
0.166
Show in viewer
Surrounding area
Pocket 4 P2Rank #4
0.048
Show in viewer
Surrounding area
Pocket 5 P2Rank #5
0.046
Show in viewer
Surrounding area
All structural evidence 0 experimental · 2 predicted

Structural evidence

0 + 2

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB AF_A0A0H3GY76
AlphaFold DB full sequence Viewing
ColabFold KP13_02712
ColabFold full sequence Loaded

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

33 records
Chemistry signal

Structural ligand evidence is available for this target.

Direct evidence 0 same-protein records
Transferred evidence 7 records from similar proteins
Structural ligands 7 0 loaded crystals
Measured bioactivity 0 direct and transferred ChEMBL records
Proposed compounds 26 similarity-based ZINC candidates
Best available ligand signal
APR PDB via homolog 559.3 Da · LogP -3.28 · TPSA 291.5 Open detail RCSB PDB
AZI PDB via homolog Detail RCSB PDB
BU3 PDB via homolog Detail RCSB PDB
CA6 PDB via homolog Detail RCSB PDB
CA8 PDB via homolog Detail RCSB PDB

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
APR RCSB PDB Q52437 559.3 Da LogP -3.28 TPSA 291.5 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AZI RCSB PDB Q5XC60 42.0 Da LogP 0.87 TPSA 58.7 ✓ Ro5 Alert [N-]=[N+]=[N-]
BU3 RCSB PDB Q47QF8 90.1 Da LogP -0.25 TPSA 40.5 ✓ Ro5 ✓ Clean C[C@H]([C@@H](C)O)O
CA6 RCSB PDB Q2FIA5 841.6 Da LogP -1.77 TPSA 380.7 3 viol. ✓ Clean CC(C)(CO[P@](=O)(O)O[P@@](=O)(O)OC[C@@H]1[C@H](…
CA8 RCSB PDB Q2FIA5 903.7 Da LogP -0.34 TPSA 380.7 3 viol. ✓ Clean CC(C)(CO[P@](=O)(O)O[P@@](=O)(O)OC[C@@H]1[C@H](…
CAJ RCSB PDB Q2FIA5 835.6 Da LogP -0.86 TPSA 372.9 3 viol. ✓ Clean CCOC(=O)CCCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@](…
OXY RCSB PDB Q03Q85 32.0 Da LogP 0.07 TPSA 34.1 ✓ Ro5 ✓ Clean O=O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.

Cross-references

External database identifiers for this protein, its structures, ligands, and metabolic reactions.